Carg24205 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATATTATCAAGCACCCTTCACTATTTCGGATAGTATTTATGGTTCTACCTTTTTCTTAGCAACTAGCTTTCATGGTTTTCATGTGATTATAGGTACTCTTTTCTTGATCATATGTGGTATTCGCCAATATCTTGGTCATCTGACCAAGGAGCATCACGTTGGCTTTGAAGCAGCTGCATGGTACTGGCATTTTGTAGACGTGGTTCGGTTATTCCTATTTGTCTCTATCTATTGGTGGGGAGGTATATGA ATGGAATATTATCAAGCACCCTTCACTATTTCGGATAGTACTCTTTTCTTGATCATATGTGGTATTCGCCAATATCTTGGTCATCTGACCAAGGAGCATCACGTTGGCTTTGAAGCAGCTGCATGGTACTGGCATTTTGTAGACGTGGTTCGGTTATTCCTATTTGTCTCTATCTATTGGTGGGGAGGTATATGA ATGGAATATTATCAAGCACCCTTCACTATTTCGGATAGTACTCTTTTCTTGATCATATGTGGTATTCGCCAATATCTTGGTCATCTGACCAAGGAGCATCACGTTGGCTTTGAAGCAGCTGCATGGTACTGGCATTTTGTAGACGTGGTTCGGTTATTCCTATTTGTCTCTATCTATTGGTGGGGAGGTATATGA MEYYQAPFTISDSTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWHFVDVVRLFLFVSIYWWGGI Homology
BLAST of Carg24205 vs. NCBI nr
Match: KAG7020921.1 (Cytochrome c oxidase subunit 3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 141.7 bits (356), Expect = 2.1e-30 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Carg24205 vs. NCBI nr
Match: AHX81461.1 (cytochrome c oxidase subunit 3 [Licania sprucei] >AHX81480.1 cytochrome c oxidase subunit 3 [Hirtella physophora] >AHX81483.1 cytochrome c oxidase subunit 3 [Chrysobalanus icaco] >AHX81512.1 cytochrome c oxidase subunit 3 [Licania alba] >AHX81524.1 cytochrome c oxidase subunit 3 [Licania heteromorpha] >AHX81536.1 cytochrome c oxidase subunit 3 [Hirtella racemosa] >AHX81539.1 cytochrome c oxidase subunit 3 [Parinari campestris] >AHX81546.1 cytochrome c oxidase subunit 3 [Couepia guianensis]) HSP 1 Score: 129.8 bits (325), Expect = 8.4e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. NCBI nr
Match: XP_023520730.1 (uncharacterized protein LOC111784179 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 129.8 bits (325), Expect = 8.4e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. NCBI nr
Match: XP_022975233.1 (uncharacterized protein LOC111474342 [Cucurbita maxima]) HSP 1 Score: 129.8 bits (325), Expect = 8.4e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. NCBI nr
Match: QXE45619.1 (cytochrome c oxidase subunit 3 [Pachyrhizus erosus]) HSP 1 Score: 129.8 bits (325), Expect = 8.4e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy Swiss-Prot
Match: P92514 (Cytochrome c oxidase subunit 3 OS=Arabidopsis thaliana OX=3702 GN=COX3 PE=2 SV=2) HSP 1 Score: 126.7 bits (317), Expect = 9.3e-29 Identity = 63/84 (75.00%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy Swiss-Prot
Match: P14853 (Cytochrome c oxidase subunit 3 OS=Glycine max OX=3847 GN=COX3 PE=2 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 9.3e-29 Identity = 63/84 (75.00%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy Swiss-Prot
Match: P08745 (Cytochrome c oxidase subunit 3 OS=Oenothera berteroana OX=3950 GN=COX3 PE=3 SV=2) HSP 1 Score: 123.6 bits (309), Expect = 7.9e-28 Identity = 62/84 (73.81%), Postives = 62/84 (73.81%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy Swiss-Prot
Match: Q03227 (Cytochrome c oxidase subunit 3 OS=Vicia faba OX=3906 GN=COX3 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.0e-27 Identity = 61/84 (72.62%), Postives = 62/84 (73.81%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy Swiss-Prot
Match: P14852 (Cytochrome c oxidase subunit 3 OS=Oryza sativa subsp. indica OX=39946 GN=COX3 PE=3 SV=2) HSP 1 Score: 122.1 bits (305), Expect = 2.3e-27 Identity = 60/84 (71.43%), Postives = 62/84 (73.81%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy TrEMBL
Match: E9KZN7 (Cytochrome c oxidase subunit 3 OS=Vigna radiata var. radiata OX=3916 GN=cox3 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.1e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy TrEMBL
Match: A0A0R0H600 (Cytochrome c oxidase subunit 3 OS=Glycine max OX=3847 GN=100780641 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.1e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy TrEMBL
Match: E9P2B2 (Cytochrome c oxidase subunit 3 OS=Ricinus communis OX=3988 GN=cox3 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.1e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy TrEMBL
Match: A0A023T2P2 (Cytochrome c oxidase subunit 3 OS=Hirtella racemosa OX=1125932 GN=cox3 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.1e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. ExPASy TrEMBL
Match: A0A6J1IIM7 (Cytochrome c oxidase subunit 3 OS=Cucurbita maxima OX=3661 GN=LOC111474342 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.1e-27 Identity = 64/84 (76.19%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Carg24205 vs. TAIR 10
Match: AT2G07687.1 (Cytochrome c oxidase, subunit III ) HSP 1 Score: 126.7 bits (317), Expect = 6.6e-30 Identity = 63/84 (75.00%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Carg24205 vs. TAIR 10
Match: ATMG00730.1 (cytochrome c oxidase subunit 3 ) HSP 1 Score: 126.7 bits (317), Expect = 6.6e-30 Identity = 63/84 (75.00%), Postives = 63/84 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|