Carg24172 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACTAGGTGGAGGAGCTCCCCAGAGAGGAAGTGCGGCAGCTACTGCCAGCATGCGCAGGAGAAGGACGACAAGTTCAGGTACATCTGGAGGGGCAGCTGGAACAATGCTGCAATTTTACACGGATGATGCTCCTGGCCTCAAGATCTCCCCCAACGTTGTACTCGTCATGAGCATTGGTTTCATTGCGTTTGTTGCCATTCTCCATGTTATGGGAAAGCTGTACTTCGTGCGAAGAGAAGCCTAG ATGGCACTAGGTGGAGGAGCTCCCCAGAGAGGAAGTGCGGCAGCTACTGCCAGCATGCGCAGGAGAAGGACGACAAGTTCAGGTACATCTGGAGGGGCAGCTGGAACAATGCTGCAATTTTACACGGATGATGCTCCTGGCCTCAAGATCTCCCCCAACGTTGTACTCGTCATGAGCATTGGTTTCATTGCGTTTGTTGCCATTCTCCATGTTATGGGAAAGCTGTACTTCGTGCGAAGAGAAGCCTAG ATGGCACTAGGTGGAGGAGCTCCCCAGAGAGGAAGTGCGGCAGCTACTGCCAGCATGCGCAGGAGAAGGACGACAAGTTCAGGTACATCTGGAGGGGCAGCTGGAACAATGCTGCAATTTTACACGGATGATGCTCCTGGCCTCAAGATCTCCCCCAACGTTGTACTCGTCATGAGCATTGGTTTCATTGCGTTTGTTGCCATTCTCCATGTTATGGGAAAGCTGTACTTCGTGCGAAGAGAAGCCTAG MALGGGAPQRGSAAATASMRRRRTTSSGTSGGAAGTMLQFYTDDAPGLKISPNVVLVMSIGFIAFVAILHVMGKLYFVRREA Homology
BLAST of Carg24172 vs. NCBI nr
Match: XP_022950482.1 (protein transport protein Sec61 subunit beta-like [Cucurbita moschata] >XP_022974254.1 protein transport protein Sec61 subunit beta-like [Cucurbita maxima] >XP_022975750.1 protein transport protein Sec61 subunit beta-like [Cucurbita maxima] >XP_023541021.1 protein transport protein Sec61 subunit beta-like [Cucurbita pepo subsp. pepo] >KAG6597025.1 Protein transport protein Sec61 subunit beta, partial [Cucurbita argyrosperma subsp. sororia] >KAG7028503.1 Protein transport protein Sec61 subunit beta, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 151.4 bits (381), Expect = 3.5e-33 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Carg24172 vs. NCBI nr
Match: XP_011650635.1 (protein transport protein Sec61 subunit beta [Cucumis sativus]) HSP 1 Score: 149.4 bits (376), Expect = 1.3e-32 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Carg24172 vs. NCBI nr
Match: XP_038875187.1 (protein transport protein Sec61 subunit beta-like isoform X1 [Benincasa hispida]) HSP 1 Score: 149.1 bits (375), Expect = 1.7e-32 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Carg24172 vs. NCBI nr
Match: XP_022146520.1 (protein transport protein Sec61 subunit beta-like [Momordica charantia] >XP_022924769.1 protein transport protein Sec61 subunit beta-like [Cucurbita moschata] >XP_022924770.1 protein transport protein Sec61 subunit beta-like [Cucurbita moschata] >XP_022980768.1 protein transport protein Sec61 subunit beta-like [Cucurbita maxima] >XP_023526368.1 protein transport protein Sec61 subunit beta-like [Cucurbita pepo subsp. pepo] >XP_038875266.1 protein transport protein Sec61 subunit beta-like isoform X2 [Benincasa hispida] >KAG6582719.1 Protein transport protein Sec61 subunit beta, partial [Cucurbita argyrosperma subsp. sororia] >KAG7020688.1 Protein transport protein Sec61 subunit beta, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 149.1 bits (375), Expect = 1.7e-32 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Carg24172 vs. NCBI nr
Match: KAB1225231.1 (Protein transport protein Sec61 subunit beta [Morella rubra]) HSP 1 Score: 146.0 bits (367), Expect = 1.5e-31 Identity = 79/82 (96.34%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy Swiss-Prot
Match: P38389 (Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana OX=3702 GN=At2g45070 PE=1 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.3e-27 Identity = 67/81 (82.72%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy Swiss-Prot
Match: A8I6P9 (Protein transport protein Sec61 subunit beta OS=Chlamydomonas reinhardtii OX=3055 GN=SEC61B PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-08 Identity = 37/76 (48.68%), Postives = 46/76 (60.53%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy Swiss-Prot
Match: Q9HFC7 (Protein transport protein Sec61 subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SBH1 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 9.9e-07 Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy Swiss-Prot
Match: P60467 (Protein transport protein Sec61 subunit beta OS=Canis lupus familiaris OX=9615 GN=SEC61B PE=1 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 6.4e-06 Identity = 34/78 (43.59%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy Swiss-Prot
Match: P60468 (Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 6.4e-06 Identity = 34/78 (43.59%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy TrEMBL
Match: A0A6J1IH25 (Protein transport protein Sec61 subunit beta OS=Cucurbita maxima OX=3661 GN=LOC111472887 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 1.7e-33 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy TrEMBL
Match: A0A6J1GEY3 (Protein transport protein Sec61 subunit beta OS=Cucurbita moschata OX=3662 GN=LOC111453574 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 1.7e-33 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy TrEMBL
Match: A0A0A0L6Y8 (Protein transport protein Sec61 subunit beta OS=Cucumis sativus OX=3659 GN=Csa_3G117430 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 6.4e-33 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy TrEMBL
Match: A0A6J1EFZ9 (Protein transport protein Sec61 subunit beta OS=Cucurbita moschata OX=3662 GN=LOC111432170 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 8.3e-33 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Carg24172 vs. ExPASy TrEMBL
Match: A0A6J1J088 (Protein transport protein Sec61 subunit beta OS=Cucurbita maxima OX=3661 GN=LOC111480059 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 8.3e-33 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Carg24172 vs. TAIR 10
Match: AT2G45070.1 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-28 Identity = 67/81 (82.72%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Carg24172 vs. TAIR 10
Match: AT2G45070.2 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-28 Identity = 67/81 (82.72%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Carg24172 vs. TAIR 10
Match: AT2G45070.3 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-28 Identity = 67/81 (82.72%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Carg24172 vs. TAIR 10
Match: AT2G45070.4 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-28 Identity = 67/81 (82.72%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Carg24172 vs. TAIR 10
Match: AT3G60540.1 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 120.9 bits (302), Expect = 4.7e-28 Identity = 65/78 (83.33%), Postives = 72/78 (92.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|