Carg22628 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGAGTCGGAGGCAATGAGGGCAGAATGCGAGCGAATCTTCAACCGCTTCGACTGCAACGGGGACGGCAAGATCTCGCTGTCGGAGTTGGAGAACGCTCTCCACGCACTTGGCTCCTCCTCGCCGGAGGAGGTCCGGCGGCGGATGTCGGAGATCGACAAGGACGGCAACGGCTTCATTTCCCTAGATGAACTGTGCGAGTTTCAGAGGGCTAATCCCGATTTGATGAAGGAGGTCTGCAAAAGGCTTTAG ATGGCGGAGTCGGAGGCAATGAGGGCAGAATGCGAGCGAATCTTCAACCGCTTCGACTGCAACGGGGACGGCAAGATCTCGCTGTCGGAGTTGGAGAACGCTCTCCACGCACTTGGCTCCTCCTCGCCGGAGGAGGTCCGGCGGCGGATGTCGGAGATCGACAAGGACGGCAACGGCTTCATTTCCCTAGATGAACTGTGCGAGTTTCAGAGGGCTAATCCCGATTTGATGAAGGAGGTCTGCAAAAGGCTTTAG ATGGCGGAGTCGGAGGCAATGAGGGCAGAATGCGAGCGAATCTTCAACCGCTTCGACTGCAACGGGGACGGCAAGATCTCGCTGTCGGAGTTGGAGAACGCTCTCCACGCACTTGGCTCCTCCTCGCCGGAGGAGGTCCGGCGGCGGATGTCGGAGATCGACAAGGACGGCAACGGCTTCATTTCCCTAGATGAACTGTGCGAGTTTCAGAGGGCTAATCCCGATTTGATGAAGGAGGTCTGCAAAAGGCTTTAG MAESEAMRAECERIFNRFDCNGDGKISLSELENALHALGSSSPEEVRRRMSEIDKDGNGFISLDELCEFQRANPDLMKEVCKRL Homology
BLAST of Carg22628 vs. NCBI nr
Match: XP_022929895.1 (polcalcin Phl p 7-like [Cucurbita moschata] >KAG6575329.1 hypothetical protein SDJN03_25968, partial [Cucurbita argyrosperma subsp. sororia] >KAG7013869.1 hypothetical protein SDJN02_24038, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 172.6 bits (436), Expect = 1.5e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Carg22628 vs. NCBI nr
Match: XP_023549323.1 (polcalcin Phl p 7-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 169.9 bits (429), Expect = 9.6e-39 Identity = 82/84 (97.62%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Carg22628 vs. NCBI nr
Match: XP_022992461.1 (polcalcin Phl p 7-like [Cucurbita maxima]) HSP 1 Score: 166.8 bits (421), Expect = 8.1e-38 Identity = 82/84 (97.62%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of Carg22628 vs. NCBI nr
Match: XP_038886760.1 (polcalcin Phl p 7-like [Benincasa hispida]) HSP 1 Score: 151.8 bits (382), Expect = 2.7e-33 Identity = 74/84 (88.10%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of Carg22628 vs. NCBI nr
Match: XP_022150429.1 (polcalcin Syr v 3-like [Momordica charantia]) HSP 1 Score: 146.0 bits (367), Expect = 1.5e-31 Identity = 71/84 (84.52%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy Swiss-Prot
Match: Q84V36 (Polcalcin Che a 3 OS=Chenopodium album OX=3559 PE=1 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.0e-19 Identity = 48/74 (64.86%), Postives = 57/74 (77.03%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy Swiss-Prot
Match: O82040 (Polcalcin Phl p 7 OS=Phleum pratense OX=15957 GN=P7 PE=1 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 5.2e-19 Identity = 47/76 (61.84%), Postives = 56/76 (73.68%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy Swiss-Prot
Match: P58171 (Polcalcin Syr v 3 OS=Syringa vulgaris OX=34270 GN=SYRV3 PE=1 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.1e-18 Identity = 46/74 (62.16%), Postives = 55/74 (74.32%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy Swiss-Prot
Match: O81092 (Polcalcin Ole e 3 OS=Olea europaea OX=4146 GN=OLE3 PE=1 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.5e-18 Identity = 48/82 (58.54%), Postives = 57/82 (69.51%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy Swiss-Prot
Match: P94092 (Polcalcin Cyn d 7 OS=Cynodon dactylon OX=28909 PE=1 SV=2) HSP 1 Score: 92.4 bits (228), Expect = 2.6e-18 Identity = 45/73 (61.64%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy TrEMBL
Match: A0A6J1EVJ6 (polcalcin Phl p 7-like OS=Cucurbita moschata OX=3662 GN=LOC111436362 PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 7.2e-40 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy TrEMBL
Match: A0A6J1JTM0 (polcalcin Phl p 7-like OS=Cucurbita maxima OX=3661 GN=LOC111488757 PE=4 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 3.9e-38 Identity = 82/84 (97.62%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy TrEMBL
Match: A0A0A0KAW9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G041150 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 3.2e-32 Identity = 71/84 (84.52%), Postives = 77/84 (91.67%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy TrEMBL
Match: A0A6J1DA15 (polcalcin Syr v 3-like OS=Momordica charantia OX=3673 GN=LOC111018587 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 7.2e-32 Identity = 71/84 (84.52%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of Carg22628 vs. ExPASy TrEMBL
Match: A0A5A7V7E6 (Polcalcin Syr v 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1213G00200 PE=4 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 3.6e-31 Identity = 71/84 (84.52%), Postives = 77/84 (91.67%), Query Frame = 0
BLAST of Carg22628 vs. TAIR 10
Match: AT3G03430.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 84.3 bits (207), Expect = 5.0e-17 Identity = 41/75 (54.67%), Postives = 55/75 (73.33%), Query Frame = 0
BLAST of Carg22628 vs. TAIR 10
Match: AT5G17480.1 (pollen calcium-binding protein 1 ) HSP 1 Score: 84.3 bits (207), Expect = 5.0e-17 Identity = 42/75 (56.00%), Postives = 54/75 (72.00%), Query Frame = 0
BLAST of Carg22628 vs. TAIR 10
Match: AT5G37770.1 (EF hand calcium-binding protein family ) HSP 1 Score: 62.4 bits (150), Expect = 2.0e-10 Identity = 30/57 (52.63%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of Carg22628 vs. TAIR 10
Match: AT1G66400.1 (calmodulin like 23 ) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-09 Identity = 29/57 (50.88%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of Carg22628 vs. TAIR 10
Match: AT1G73630.1 (EF hand calcium-binding protein family ) HSP 1 Score: 59.7 bits (143), Expect = 1.3e-09 Identity = 29/65 (44.62%), Postives = 46/65 (70.77%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|