Carg22624 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGAGGCAGCTGGAGGCTCACCACTTCTGCGCCCACCTGAACGAGGAGGTCCGACAGTGTCTGATCTACGACAGCCCCGAGAAGGACGCTAGGCTGATCGGTGAGAATATTTGCTAA ATGACGAGGCAGCTGGAGGCTCACCACTTCTGCGCCCACCTGAACGAGGAGGTCCGACAGTGTCTGATCTACGACAGCCCCGAGAAGGACGCTAGGCTGATCGGTGAGAATATTTGCTAA ATGACGAGGCAGCTGGAGGCTCACCACTTCTGCGCCCACCTGAACGAGGAGGTCCGACAGTGTCTGATCTACGACAGCCCCGAGAAGGACGCTAGGCTGATCGGTGAGAATATTTGCTAA MTRQLEAHHFCAHLNEEVRQCLIYDSPEKDARLIGENIC Homology
BLAST of Carg22624 vs. NCBI nr
Match: KAG7013873.1 (Oil body-associated protein 1A, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 88.2 bits (217), Expect = 1.7e-14 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. NCBI nr
Match: XP_022929874.1 (oil body-associated protein 1A-like [Cucurbita moschata]) HSP 1 Score: 79.0 bits (193), Expect = 1.0e-11 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. NCBI nr
Match: XP_022992382.1 (oil body-associated protein 1A-like [Cucurbita maxima]) HSP 1 Score: 77.8 bits (190), Expect = 2.3e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. NCBI nr
Match: KAA0050567.1 (oil body-associated protein 1A-like [Cucumis melo var. makuwa] >TYK18806.1 oil body-associated protein 1A-like [Cucumis melo var. makuwa]) HSP 1 Score: 77.4 bits (189), Expect = 3.0e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. NCBI nr
Match: XP_008462003.1 (PREDICTED: oil body-associated protein 1A-like [Cucumis melo]) HSP 1 Score: 77.4 bits (189), Expect = 3.0e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy Swiss-Prot
Match: Q9ZVY7 (Oil body-associated protein 1A OS=Arabidopsis thaliana OX=3702 GN=OBAP1A PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 9.1e-11 Identity = 26/35 (74.29%), Postives = 32/35 (91.43%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy Swiss-Prot
Match: Q8GWR2 (Oil body-associated protein 1B OS=Arabidopsis thaliana OX=3702 GN=OBAP1B PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.6e-10 Identity = 26/35 (74.29%), Postives = 32/35 (91.43%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy Swiss-Prot
Match: B4FFZ9 (Oil body-associated protein 1A OS=Zea mays OX=4577 GN=OBAP1A PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 7.7e-10 Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy Swiss-Prot
Match: B6UI56 (Oil body-associated protein 2B OS=Zea mays OX=4577 GN=OBAP2B PE=2 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 2.0e-05 Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy Swiss-Prot
Match: B4FFK9 (Oil body-associated protein 2A OS=Zea mays OX=4577 GN=OBAP2A PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 7.5e-05 Identity = 18/33 (54.55%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy TrEMBL
Match: A0A6J1EQ17 (oil body-associated protein 1A-like OS=Cucurbita moschata OX=3662 GN=LOC111436352 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 5.0e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy TrEMBL
Match: A0A6J1JPN4 (oil body-associated protein 1A-like OS=Cucurbita maxima OX=3661 GN=LOC111488706 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.1e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy TrEMBL
Match: A0A5D3D5L2 (Oil body-associated protein 1A-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold945G00240 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.5e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy TrEMBL
Match: A0A1S3CGF6 (oil body-associated protein 1A-like OS=Cucumis melo OX=3656 GN=LOC103500478 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.5e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. ExPASy TrEMBL
Match: A0A0A0K538 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G336470 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.3e-11 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of Carg22624 vs. TAIR 10
Match: AT1G05510.1 (Protein of unknown function (DUF1264) ) HSP 1 Score: 66.2 bits (160), Expect = 6.5e-12 Identity = 26/35 (74.29%), Postives = 32/35 (91.43%), Query Frame = 0
BLAST of Carg22624 vs. TAIR 10
Match: AT2G31985.1 (Protein of unknown function (DUF1264) ) HSP 1 Score: 65.5 bits (158), Expect = 1.1e-11 Identity = 26/35 (74.29%), Postives = 32/35 (91.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|