![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Carg19229 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGGTTCGACTTGGTTTTCTATTATCTTCATTGCTTTCTTACTTTTCCCAACACCCATTTCCTCACAACGCATTTCTCACCAGAACTCACGTAATCACTCATACCTTCAACACCCATTTCATGTCTTCAATGCTTTTCTTCGTTCCGCCATGAACTAACCTTCATGACTTGTGTGCAGGTCATGTCCACCACCGCAAGATGGCGGCAGAAGAGGCGGCGATGGGGAGAAAAGGGGTGGAGACAGTTGAAGTAGCAGGGTCGAGCTTGCCGGACTGCTCGCATGCGTGTGCCTCGTGCTCGCCGTGCAGACTAGTGATGATAAGTTTT ATGAAGGGTTCGACTTGGTTTTCTATTATCTTCATTGCTTTCTTACTTTTCCCAACACCCATTTCCTCACAACGCATTTCTCACCAGAACTCACGTCATGTCCACCACCGCAAGATGGCGGCAGAAGAGGCGGCGATGGGGAGAAAAGGGGTGGAGACAGTTGAAGTAGCAGGGTCGAGCTTGCCGGACTGCTCGCATGCGTGTGCCTCGTGCTCGCCGTGCAGACTAGTGATGATAAGTTTT ATGAAGGGTTCGACTTGGTTTTCTATTATCTTCATTGCTTTCTTACTTTTCCCAACACCCATTTCCTCACAACGCATTTCTCACCAGAACTCACGTCATGTCCACCACCGCAAGATGGCGGCAGAAGAGGCGGCGATGGGGAGAAAAGGGGTGGAGACAGTTGAAGTAGCAGGGTCGAGCTTGCCGGACTGCTCGCATGCGTGTGCCTCGTGCTCGCCGTGCAGACTAGTGATGATAAGTTTT MKGSTWFSIIFIAFLLFPTPISSQRISHQNSRHVHHRKMAAEEAAMGRKGVETVEVAGSSLPDCSHACASCSPCRLVMISF Homology
BLAST of Carg19229 vs. NCBI nr
Match: KAG7011966.1 (Protein EPIDERMAL PATTERNING FACTOR 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 164.9 bits (416), Expect = 3.0e-37 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of Carg19229 vs. NCBI nr
Match: KAG6572355.1 (Protein EPIDERMAL PATTERNING FACTOR 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 164.9 bits (416), Expect = 3.0e-37 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of Carg19229 vs. NCBI nr
Match: XP_022953138.1 (protein EPIDERMAL PATTERNING FACTOR 1 [Cucurbita moschata]) HSP 1 Score: 135.2 bits (339), Expect = 2.5e-28 Identity = 70/81 (86.42%), Postives = 71/81 (87.65%), Query Frame = 0
BLAST of Carg19229 vs. NCBI nr
Match: XP_038888568.1 (protein EPIDERMAL PATTERNING FACTOR 1 [Benincasa hispida]) HSP 1 Score: 124.4 bits (311), Expect = 4.5e-25 Identity = 63/92 (68.48%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of Carg19229 vs. NCBI nr
Match: XP_004136818.1 (protein EPIDERMAL PATTERNING FACTOR 1 [Cucumis sativus] >KGN43602.1 hypothetical protein Csa_020445 [Cucumis sativus]) HSP 1 Score: 120.9 bits (302), Expect = 4.9e-24 Identity = 69/97 (71.13%), Postives = 72/97 (74.23%), Query Frame = 0
BLAST of Carg19229 vs. ExPASy Swiss-Prot
Match: Q8S8I4 (Protein EPIDERMAL PATTERNING FACTOR 1 OS=Arabidopsis thaliana OX=3702 GN=EPF1 PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.8e-08 Identity = 29/52 (55.77%), Postives = 34/52 (65.38%), Query Frame = 0
BLAST of Carg19229 vs. ExPASy Swiss-Prot
Match: Q8LC53 (Protein EPIDERMAL PATTERNING FACTOR 2 OS=Arabidopsis thaliana OX=3702 GN=EPF2 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.2e-04 Identity = 23/47 (48.94%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of Carg19229 vs. ExPASy TrEMBL
Match: A0A6J1GMI9 (Epidermal patterning factor-like protein OS=Cucurbita moschata OX=3662 GN=LOC111455631 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.2e-28 Identity = 70/81 (86.42%), Postives = 71/81 (87.65%), Query Frame = 0
BLAST of Carg19229 vs. ExPASy TrEMBL
Match: A0A0A0K5P8 (Epidermal patterning factor-like protein OS=Cucumis sativus OX=3659 GN=Csa_7G047370 PE=3 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 2.4e-24 Identity = 69/97 (71.13%), Postives = 72/97 (74.23%), Query Frame = 0
BLAST of Carg19229 vs. ExPASy TrEMBL
Match: A0A1S3C0N9 (Epidermal patterning factor-like protein OS=Cucumis melo OX=3656 GN=LOC103495522 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 4.5e-23 Identity = 65/95 (68.42%), Postives = 66/95 (69.47%), Query Frame = 0
BLAST of Carg19229 vs. ExPASy TrEMBL
Match: A0A6J1ESJ9 (Epidermal patterning factor-like protein OS=Cucurbita moschata OX=3662 GN=LOC111437184 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 8.5e-22 Identity = 63/102 (61.76%), Postives = 66/102 (64.71%), Query Frame = 0
BLAST of Carg19229 vs. ExPASy TrEMBL
Match: A0A6J1JEL1 (Epidermal patterning factor-like protein OS=Cucurbita maxima OX=3661 GN=LOC111486204 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.9e-21 Identity = 61/94 (64.89%), Postives = 65/94 (69.15%), Query Frame = 0
BLAST of Carg19229 vs. TAIR 10
Match: AT2G20875.1 (epidermal patterning factor 1 ) HSP 1 Score: 59.7 bits (143), Expect = 1.3e-09 Identity = 29/52 (55.77%), Postives = 34/52 (65.38%), Query Frame = 0
BLAST of Carg19229 vs. TAIR 10
Match: AT1G34245.1 (Putative membrane lipoprotein ) HSP 1 Score: 47.0 bits (110), Expect = 8.5e-06 Identity = 23/47 (48.94%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of Carg19229 vs. TAIR 10
Match: AT1G71866.1 (LOCATED IN: endomembrane system; BEST Arabidopsis thaliana protein match is: Putative membrane lipoprotein (TAIR:AT1G34245.1). ) HSP 1 Score: 42.0 bits (97), Expect = 2.7e-04 Identity = 16/26 (61.54%), Postives = 22/26 (84.62%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|