![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Carg17943 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCAAGAGAAATTCGGTTACTTGGAATGCTCTGATTATTGGTTATACTCATAATAGAAAGTTTATGGAAGCTATCAATGCTTTCAGAGGAATGCTGGCAGCTGGGACTGAACCGAGTGAAAGAACCGCGGTGGTAGTTCTATTGGCTTGTTCTCATTTGGGAGCTTTAAATCAGGGAAAGTGGAACTATGGATTTATATATCAGAATGATTTGAGACTGAACGTGTTTGTGGGCACAGCACTCACTGATATGTATGCTAAATGTGGGGCTGTGATGAGGCAAAGAAGGTCTTTGAAGAAATTGGAGAGAAGAACATCTGTACATGGAATGTCTTGA ATGCCCAAGAGAAATTCGGTTACTTGGAATGCTCTGATTATTGGTTATACTCATAATAGAAAGTTTATGGAAGCTATCAATGCTTTCAGAGGAATGCTGGCAGCTGGGACTGAACCGAGTGAAAGAACCGCGGTGGTAGTTCTATTGGCTTGTTCTCATTTGGGAGCTTTAAATCAGGGAAAGTGGAACTATGGATTTATATATCAGAATGATTTGAGACTGAACGTGTTTGTGGGCACAGCACTCACTGATATGTATGCTAAATGTGGGGCTGTGATGAGGCAAAGAAGGTCTTTGAAGAAATTGGAGAGAAGAACATCTGTACATGGAATGTCTTGA ATGCCCAAGAGAAATTCGGTTACTTGGAATGCTCTGATTATTGGTTATACTCATAATAGAAAGTTTATGGAAGCTATCAATGCTTTCAGAGGAATGCTGGCAGCTGGGACTGAACCGAGTGAAAGAACCGCGGTGGTAGTTCTATTGGCTTGTTCTCATTTGGGAGCTTTAAATCAGGGAAAGTGGAACTATGGATTTATATATCAGAATGATTTGAGACTGAACGTGTTTGTGGGCACAGCACTCACTGATATGTATGCTAAATGTGGGGCTGTGATGAGGCAAAGAAGGTCTTTGAAGAAATTGGAGAGAAGAACATCTGTACATGGAATGTCTTGA MPKRNSVTWNALIIGYTHNRKFMEAINAFRGMLAAGTEPSERTAVVVLLACSHLGALNQGKWNYGFIYQNDLRLNVFVGTALTDMYAKCGAVMRQRRSLKKLERRTSVHGMS Homology
BLAST of Carg17943 vs. NCBI nr
Match: KAG7023213.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 231.1 bits (588), Expect = 4.7e-57 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of Carg17943 vs. NCBI nr
Match: KAG6589528.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 227.3 bits (578), Expect = 6.8e-56 Identity = 110/112 (98.21%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of Carg17943 vs. NCBI nr
Match: XP_022134759.1 (pentatricopeptide repeat-containing protein At4g21065-like [Momordica charantia]) HSP 1 Score: 169.1 bits (427), Expect = 2.2e-38 Identity = 81/105 (77.14%), Postives = 88/105 (83.81%), Query Frame = 0
BLAST of Carg17943 vs. NCBI nr
Match: XP_022925029.1 (pentatricopeptide repeat-containing protein At4g21065-like [Cucurbita moschata]) HSP 1 Score: 168.3 bits (425), Expect = 3.7e-38 Identity = 81/105 (77.14%), Postives = 87/105 (82.86%), Query Frame = 0
BLAST of Carg17943 vs. NCBI nr
Match: XP_023529316.1 (pentatricopeptide repeat-containing protein At4g21065-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 167.9 bits (424), Expect = 4.9e-38 Identity = 80/102 (78.43%), Postives = 86/102 (84.31%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy Swiss-Prot
Match: Q9SJG6 (Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-E75 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.4e-18 Identity = 41/92 (44.57%), Postives = 59/92 (64.13%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy Swiss-Prot
Match: Q683I9 (Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H82 PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 4.5e-18 Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy Swiss-Prot
Match: Q9C866 (Pentatricopeptide repeat-containing protein At1g31430 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E55 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.9e-17 Identity = 40/91 (43.96%), Postives = 55/91 (60.44%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy Swiss-Prot
Match: Q9SX45 (Pentatricopeptide repeat-containing protein At1g50270 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E42 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.4e-17 Identity = 39/92 (42.39%), Postives = 58/92 (63.04%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy Swiss-Prot
Match: Q38959 (Pentatricopeptide repeat-containing protein At3g26630, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-A6 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.4e-17 Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy TrEMBL
Match: A0A6J1BZP4 (pentatricopeptide repeat-containing protein At4g21065-like OS=Momordica charantia OX=3673 GN=LOC111006955 PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 1.1e-38 Identity = 81/105 (77.14%), Postives = 88/105 (83.81%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy TrEMBL
Match: A0A6J1EAY2 (pentatricopeptide repeat-containing protein At4g21065-like OS=Cucurbita moschata OX=3662 GN=LOC111432395 PE=3 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.8e-38 Identity = 81/105 (77.14%), Postives = 87/105 (82.86%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy TrEMBL
Match: A0A6J1KY52 (pentatricopeptide repeat-containing protein At4g21065-like OS=Cucurbita maxima OX=3661 GN=LOC111497411 PE=3 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 3.1e-38 Identity = 80/102 (78.43%), Postives = 86/102 (84.31%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy TrEMBL
Match: A0A5A7US40 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G002740 PE=3 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 4.9e-36 Identity = 76/105 (72.38%), Postives = 87/105 (82.86%), Query Frame = 0
BLAST of Carg17943 vs. ExPASy TrEMBL
Match: A0A1S4DZH3 (pentatricopeptide repeat-containing protein At4g21065-like OS=Cucumis melo OX=3656 GN=LOC103494017 PE=3 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 4.9e-36 Identity = 76/105 (72.38%), Postives = 87/105 (82.86%), Query Frame = 0
BLAST of Carg17943 vs. TAIR 10
Match: AT2G42920.1 (Pentatricopeptide repeat (PPR-like) superfamily protein ) HSP 1 Score: 92.4 bits (228), Expect = 2.4e-19 Identity = 41/92 (44.57%), Postives = 59/92 (64.13%), Query Frame = 0
BLAST of Carg17943 vs. TAIR 10
Match: AT3G62890.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 92.0 bits (227), Expect = 3.2e-19 Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 0
BLAST of Carg17943 vs. TAIR 10
Match: AT1G31430.1 (Pentatricopeptide repeat (PPR-like) superfamily protein ) HSP 1 Score: 88.6 bits (218), Expect = 3.5e-18 Identity = 40/91 (43.96%), Postives = 55/91 (60.44%), Query Frame = 0
BLAST of Carg17943 vs. TAIR 10
Match: AT1G50270.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 88.2 bits (217), Expect = 4.6e-18 Identity = 39/92 (42.39%), Postives = 58/92 (63.04%), Query Frame = 0
BLAST of Carg17943 vs. TAIR 10
Match: AT3G26630.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 87.8 bits (216), Expect = 6.0e-18 Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|