![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Carg14660 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAGAAGTGTGAGCTTTGCACTTCAAGAGCCAATACATATTGTGAATCCGACCAAGCCAATTTGTGTTGGAGTTGCGACGCCAATGTTCATTCAGCCAACTTCATCGTCGAGAAGCACTCCCGCACGTTGCTATGCCATATTTGCCAATCCCCCACGCCTTGGACTGCCACTGGCCGCAAGCTTTCCCCTACCATCTCCGTTTGTCAATCTTGTCTTAATGCCCAAAATAACGTCGCCGACAACCATCAAGATTCCAGCCATGGATATCGTCATGACGACAACGACGACGACGAGAATCAAGTGGTTCCATTGTCGCCGCCACCGGTTTCAAGCTCGTCAAAATGA ATGAAGAAGAAGTGTGAGCTTTGCACTTCAAGAGCCAATACATATTGTGAATCCGACCAAGCCAATTTGTGTTGGAGTTGCGACGCCAATGTTCATTCAGCCAACTTCATCGTCGAGAAGCACTCCCGCACGTTGCTATGCCATATTTGCCAATCCCCCACGCCTTGGACTGCCACTGGCCGCAAGCTTTCCCCTACCATCTCCGTTTGTCAATCTTGTCTTAATGCCCAAAATAACGTCGCCGACAACCATCAAGATTCCAGCCATGGATATCGTCATGACGACAACGACGACGACGAGAATCAAGTGGTTCCATTGTCGCCGCCACCGGTTTCAAGCTCGTCAAAATGA ATGAAGAAGAAGTGTGAGCTTTGCACTTCAAGAGCCAATACATATTGTGAATCCGACCAAGCCAATTTGTGTTGGAGTTGCGACGCCAATGTTCATTCAGCCAACTTCATCGTCGAGAAGCACTCCCGCACGTTGCTATGCCATATTTGCCAATCCCCCACGCCTTGGACTGCCACTGGCCGCAAGCTTTCCCCTACCATCTCCGTTTGTCAATCTTGTCTTAATGCCCAAAATAACGTCGCCGACAACCATCAAGATTCCAGCCATGGATATCGTCATGACGACAACGACGACGACGAGAATCAAGTGGTTCCATTGTCGCCGCCACCGGTTTCAAGCTCGTCAAAATGA MKKKCELCTSRANTYCESDQANLCWSCDANVHSANFIVEKHSRTLLCHICQSPTPWTATGRKLSPTISVCQSCLNAQNNVADNHQDSSHGYRHDDNDDDENQVVPLSPPPVSSSSK Homology
BLAST of Carg14660 vs. NCBI nr
Match: KAG6573228.1 (putative zinc finger protein CONSTANS-LIKE 11, partial [Cucurbita argyrosperma subsp. sororia] >KAG7012401.1 putative zinc finger protein CONSTANS-LIKE 11, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 245.0 bits (624), Expect = 3.3e-61 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 0
BLAST of Carg14660 vs. NCBI nr
Match: XP_023542180.1 (zinc finger protein CONSTANS-LIKE 9-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 231.9 bits (590), Expect = 2.8e-57 Identity = 113/117 (96.58%), Postives = 113/117 (96.58%), Query Frame = 0
BLAST of Carg14660 vs. NCBI nr
Match: XP_022994111.1 (zinc finger protein CONSTANS-LIKE 9-like [Cucurbita maxima]) HSP 1 Score: 225.3 bits (573), Expect = 2.7e-55 Identity = 111/118 (94.07%), Postives = 112/118 (94.92%), Query Frame = 0
BLAST of Carg14660 vs. NCBI nr
Match: XP_022954438.1 (zinc finger protein CONSTANS-LIKE 9-like [Cucurbita moschata]) HSP 1 Score: 209.5 bits (532), Expect = 1.5e-50 Identity = 104/116 (89.66%), Postives = 106/116 (91.38%), Query Frame = 0
BLAST of Carg14660 vs. NCBI nr
Match: KAE8652697.1 (hypothetical protein Csa_014317 [Cucumis sativus]) HSP 1 Score: 159.8 bits (403), Expect = 1.4e-35 Identity = 80/120 (66.67%), Postives = 90/120 (75.00%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy Swiss-Prot
Match: Q9SSE5 (Zinc finger protein CONSTANS-LIKE 9 OS=Arabidopsis thaliana OX=3702 GN=COL9 PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.2e-10 Identity = 36/85 (42.35%), Postives = 53/85 (62.35%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy Swiss-Prot
Match: O23379 (Putative zinc finger protein CONSTANS-LIKE 11 OS=Arabidopsis thaliana OX=3702 GN=COL11 PE=1 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 4.6e-10 Identity = 32/75 (42.67%), Postives = 47/75 (62.67%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy Swiss-Prot
Match: Q9LJ44 (Zinc finger protein CONSTANS-LIKE 12 OS=Arabidopsis thaliana OX=3702 GN=COL12 PE=1 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.8e-09 Identity = 35/83 (42.17%), Postives = 50/83 (60.24%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy Swiss-Prot
Match: Q9LUA9 (Zinc finger protein CONSTANS-LIKE 10 OS=Arabidopsis thaliana OX=3702 GN=COL10 PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.1e-08 Identity = 37/93 (39.78%), Postives = 51/93 (54.84%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy Swiss-Prot
Match: Q39057 (Zinc finger protein CONSTANS OS=Arabidopsis thaliana OX=3702 GN=CO PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 7.4e-08 Identity = 32/85 (37.65%), Postives = 46/85 (54.12%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy TrEMBL
Match: A0A6J1JY69 (zinc finger protein CONSTANS-LIKE 9-like OS=Cucurbita maxima OX=3661 GN=LOC111489941 PE=4 SV=1) HSP 1 Score: 225.3 bits (573), Expect = 1.3e-55 Identity = 111/118 (94.07%), Postives = 112/118 (94.92%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy TrEMBL
Match: A0A6J1GR34 (zinc finger protein CONSTANS-LIKE 9-like OS=Cucurbita moschata OX=3662 GN=LOC111456702 PE=4 SV=1) HSP 1 Score: 209.5 bits (532), Expect = 7.3e-51 Identity = 104/116 (89.66%), Postives = 106/116 (91.38%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy TrEMBL
Match: A0A0A0LS80 (B box-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G071810 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 6.7e-36 Identity = 80/120 (66.67%), Postives = 90/120 (75.00%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy TrEMBL
Match: A0A5A7UTR2 (B-box zinc finger protein 32-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold861G00230 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 7.4e-35 Identity = 79/123 (64.23%), Postives = 89/123 (72.36%), Query Frame = 0
BLAST of Carg14660 vs. ExPASy TrEMBL
Match: A0A1S3B4I3 (B-box zinc finger protein 32-like OS=Cucumis melo OX=3656 GN=LOC103485915 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 7.4e-35 Identity = 79/123 (64.23%), Postives = 89/123 (72.36%), Query Frame = 0
BLAST of Carg14660 vs. TAIR 10
Match: AT5G54470.1 (B-box type zinc finger family protein ) HSP 1 Score: 115.2 bits (287), Expect = 3.6e-26 Identity = 66/139 (47.48%), Postives = 81/139 (58.27%), Query Frame = 0
BLAST of Carg14660 vs. TAIR 10
Match: AT4G27310.1 (B-box type zinc finger family protein ) HSP 1 Score: 111.3 bits (277), Expect = 5.2e-25 Identity = 68/169 (40.24%), Postives = 82/169 (48.52%), Query Frame = 0
BLAST of Carg14660 vs. TAIR 10
Match: AT3G07650.1 (CONSTANS-like 9 ) HSP 1 Score: 67.4 bits (163), Expect = 8.7e-12 Identity = 36/85 (42.35%), Postives = 53/85 (62.35%), Query Frame = 0
BLAST of Carg14660 vs. TAIR 10
Match: AT3G07650.2 (CONSTANS-like 9 ) HSP 1 Score: 67.4 bits (163), Expect = 8.7e-12 Identity = 36/85 (42.35%), Postives = 53/85 (62.35%), Query Frame = 0
BLAST of Carg14660 vs. TAIR 10
Match: AT3G07650.3 (CONSTANS-like 9 ) HSP 1 Score: 67.4 bits (163), Expect = 8.7e-12 Identity = 36/85 (42.35%), Postives = 53/85 (62.35%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|