Carg13930 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTTTCGGCCACGTGTACTCCATCAAACTTGTACAGTACGGCTACGTTCCAAATATTCCTCCACGTAATTTCCTAGTTGTACTTCCCTTTTCCTTTTCAACTTAAAATACCAAAGGGCGTTATTCATATTCAAGCAAGTTTCAACAATACAATTGTGACTGTTACAGATGTACGGGGTCGGGTAATTTCTTGGTCCTCCACTCGTACTTGTGAATTCAAAAGTCCAAGAAGAGGGACACCATTTGCTACTCAAACCGCAGCAAAAAATGCTATTCGGGCAGTAGAAGATCAAGGCATACAACAAGCAGAAGTCATGATAAAGGGCTCTGGTCTCGGAAGAGATGCAGCGTCAAGAGCTATTCGTAGAAGCGGTATACTCTTAAGTTTCATACGGGACGTAATCTCTATGTCACATAATGACTGTAAGCCCCTGACAAAACGATCGATCAGATAAATTTTGAGTTAGTTAGATTGATAACTCGAACCACTTGAATAGAATTACTTACCAATATAGATGAATAAATTTATTTAAGATCAACATTGATAACCCTAAATTATTATATAATTAAATTTTGTATTAAGGGACATTACCGTCCTAA ATGTTTTTCGGCCACGTGTACTCCATCAAACTTGTACAGTACGGCTACGTTCCAAATATTCCTCCACATGTACGGGGTCGGGTAATTTCTTGGTCCTCCACTCGTACTTGTGAATTCAAAAGTCCAAGAAGAGGGACACCATTTGCTACTCAAACCGCAGCAAAAAATGCTATTCGGGCAGTAGAAGATCAAGGCATACAACAAGCAGAAGTCATGATAAAGGGCTCTGGTCTCGGAAGAGATGCAGCGTCAAGAGCTATTCGTAGAAGCGGGACATTACCGTCCTAA ATGTTTTTCGGCCACGTGTACTCCATCAAACTTGTACAGTACGGCTACGTTCCAAATATTCCTCCACATGTACGGGGTCGGGTAATTTCTTGGTCCTCCACTCGTACTTGTGAATTCAAAAGTCCAAGAAGAGGGACACCATTTGCTACTCAAACCGCAGCAAAAAATGCTATTCGGGCAGTAGAAGATCAAGGCATACAACAAGCAGAAGTCATGATAAAGGGCTCTGGTCTCGGAAGAGATGCAGCGTCAAGAGCTATTCGTAGAAGCGGGACATTACCGTCCTAA MFFGHVYSIKLVQYGYVPNIPPHVRGRVISWSSTRTCEFKSPRRGTPFATQTAAKNAIRAVEDQGIQQAEVMIKGSGLGRDAASRAIRRSGTLPS Homology
BLAST of Carg13930 vs. NCBI nr
Match: KAG7025899.1 (30S ribosomal protein S11, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 191.0 bits (484), Expect = 4.6e-45 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of Carg13930 vs. NCBI nr
Match: ALO21945.1 (ribosomal protein S11 [Cucurbita cordata] >ALO21975.1 ribosomal protein S11 [Cucurbita digitata] >ALO22089.1 ribosomal protein S11 [Cucurbita ficifolia] >ALO22168.1 ribosomal protein S11 [Cucurbita foetidissima] >ALO22872.1 ribosomal protein S11 [Cucurbita pedatifolia]) HSP 1 Score: 112.1 bits (279), Expect = 2.7e-21 Identity = 59/72 (81.94%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. NCBI nr
Match: YP_009447483.1 (ribosomal protein S11 [Cucurbita maxima] >YP_009447568.1 ribosomal protein S11 [Cucurbita moschata] >YP_009505113.1 ribosomal protein S11 [Cucurbita pepo] >ALO21755.1 ribosomal protein S11 [Cucurbita argyrosperma] >ALO21816.1 ribosomal protein S11 [Cucurbita argyrosperma var. palmeri] >ALO21835.1 ribosomal protein S11 [Cucurbita argyrosperma subsp. sororia] >ALO22045.1 ribosomal protein S11 [Cucurbita ecuadorensis] >ALO22279.1 ribosomal protein S11 [Cucurbita lundelliana] >ALO22303.1 ribosomal protein S11 [Cucurbita maxima subsp. andreana] >ALO22455.1 ribosomal protein S11 [Cucurbita okeechobeensis] >ALO22482.1 ribosomal protein S11 [Cucurbita okeechobeensis subsp. martinezii] >ALO22581.1 ribosomal protein S11 [Cucurbita pepo subsp. fraterna] >ALO22640.1 ribosomal protein S11 [Cucurbita pepo subsp. ovifera] >ALO22727.1 ribosomal protein S11 [Cucurbita pepo var. ozarkana] >ALO22773.1 ribosomal protein S11 [Cucurbita pepo subsp. pepo] >ALO22847.1 ribosomal protein S11 [Cucurbita pepo var. texana]) HSP 1 Score: 112.1 bits (279), Expect = 2.7e-21 Identity = 59/72 (81.94%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. NCBI nr
Match: YP_009752191.1 (ribosomal protein S11 [Linnaeosicyos amara] >QIT05601.1 ribosomal protein S11 [Linnaeosicyos amara]) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-20 Identity = 58/72 (80.56%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. NCBI nr
Match: CUR03469.1 (rps11 [Acacia jibberdingensis] >CUR03652.1 rps11 [Acacia karina] >CUR05198.1 rps11 [Acacia oldfieldii] >CUR07015.1 rps11 [Acacia stanleyi] >CUR03560.1 rps11 [Acacia jibberdingensis]) HSP 1 Score: 109.8 bits (273), Expect = 1.3e-20 Identity = 57/72 (79.17%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy Swiss-Prot
Match: A0ZZ68 (30S ribosomal protein S11, chloroplastic OS=Gossypium barbadense OX=3634 GN=rps11 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.9e-23 Identity = 58/72 (80.56%), Postives = 60/72 (83.33%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy Swiss-Prot
Match: Q2L937 (30S ribosomal protein S11, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps11 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.9e-23 Identity = 58/72 (80.56%), Postives = 60/72 (83.33%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy Swiss-Prot
Match: A4QJE8 (30S ribosomal protein S11, chloroplastic OS=Aethionema cordifolium OX=434059 GN=rps11 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.7e-23 Identity = 58/72 (80.56%), Postives = 59/72 (81.94%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy Swiss-Prot
Match: A4QJN2 (30S ribosomal protein S11, chloroplastic OS=Aethionema grandiflorum OX=72657 GN=rps11 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.7e-23 Identity = 58/72 (80.56%), Postives = 59/72 (81.94%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy Swiss-Prot
Match: B1A968 (30S ribosomal protein S11, chloroplastic OS=Carica papaya OX=3649 GN=rps11 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.7e-23 Identity = 57/72 (79.17%), Postives = 60/72 (83.33%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy TrEMBL
Match: A0A0S2IGL1 (Ribosomal protein S11 OS=Cucurbita moschata OX=3662 GN=rps11 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 59/72 (81.94%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy TrEMBL
Match: A0A0S2IE02 (Ribosomal protein S11 OS=Cucurbita argyrosperma OX=34294 GN=rps11 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 59/72 (81.94%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy TrEMBL
Match: A0A2H4T1X3 (30S ribosomal protein S11, chloroplastic OS=Cucurbita maxima OX=3661 GN=rps11 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 59/72 (81.94%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy TrEMBL
Match: A0A0S2IHL1 (Ribosomal protein S11 OS=Cucurbita pepo var. texana OX=37651 GN=rps11 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 59/72 (81.94%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. ExPASy TrEMBL
Match: A0A0S2IG71 (Ribosomal protein S11 OS=Cucurbita pepo subsp. fraterna OX=37649 GN=rps11 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 59/72 (81.94%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Carg13930 vs. TAIR 10
Match: ATCG00750.1 (ribosomal protein S11 ) HSP 1 Score: 105.1 bits (261), Expect = 3.1e-23 Identity = 56/72 (77.78%), Postives = 59/72 (81.94%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|