
Carg12399 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTCCACATGACATTTTTCTGGGGAAAGTCGGCGGAGATTCTGTTCGCCGGCTGGCCTGGCCGGAGCTCACTCTCTTACGCCATCGCCTTAGTCTTCGTCTTTCTCGTAGCCTTCGCCGTGGAGTGGCTGTCGCACACTAAACTCACCGCCTCTGTCGCCGATGACGTCTTCGCCGGCTTTGTTCAGACCGCCCTGTACGGCGTCCGGGTGGGGTTGGCTTTTGTCGTCATGCTGGCCGTCATGTCATTCAATGTCGGAGTCCTGCTTGCGGCGGTGGCCGGGTATTCGGTCGGGTTCTTGGTTTATGGGAGCCGGGTTTTTAATAGATCCAAAATTGACCTAAATTTGAATATGTCTGATATACCACCGCTTAATTGTTAA ATGGAATTCCACATGACATTTTTCTGGGGAAAGTCGGCGGAGATTCTGTTCGCCGGCTGGCCTGGCCGGAGCTCACTCTCTTACGCCATCGCCTTAGTCTTCGTCTTTCTCGTAGCCTTCGCCGTGGAGTGGCTGTCGCACACTAAACTCACCGCCTCTGTCGCCGATGACGTCTTCGCCGGCTTTGTTCAGACCGCCCTGTACGGCGTCCGGGTGGGGTTGGCTTTTGTCGTCATGCTGGCCGTCATGTCATTCAATGTCGGAGTCCTGCTTGCGGCGGTGGCCGGGTATTCGGTCGGGTTCTTGGTTTATGGGAGCCGGGTTTTTAATAGATCCAAAATTGACCTAAATTTGAATATGTCTGATATACCACCGCTTAATTGTTAA ATGGAATTCCACATGACATTTTTCTGGGGAAAGTCGGCGGAGATTCTGTTCGCCGGCTGGCCTGGCCGGAGCTCACTCTCTTACGCCATCGCCTTAGTCTTCGTCTTTCTCGTAGCCTTCGCCGTGGAGTGGCTGTCGCACACTAAACTCACCGCCTCTGTCGCCGATGACGTCTTCGCCGGCTTTGTTCAGACCGCCCTGTACGGCGTCCGGGTGGGGTTGGCTTTTGTCGTCATGCTGGCCGTCATGTCATTCAATGTCGGAGTCCTGCTTGCGGCGGTGGCCGGGTATTCGGTCGGGTTCTTGGTTTATGGGAGCCGGGTTTTTAATAGATCCAAAATTGACCTAAATTTGAATATGTCTGATATACCACCGCTTAATTGTTAA MEFHMTFFWGKSAEILFAGWPGRSSLSYAIALVFVFLVAFAVEWLSHTKLTASVADDVFAGFVQTALYGVRVGLAFVVMLAVMSFNVGVLLAAVAGYSVGFLVYGSRVFNRSKIDLNLNMSDIPPLNC Homology
BLAST of Carg12399 vs. NCBI nr
Match: XP_023525766.1 (copper transporter 1-like [Cucurbita pepo subsp. pepo] >KAG7036956.1 Copper transporter 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 247.7 bits (631), Expect = 5.5e-62 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: XP_022998910.1 (copper transporter 1-like [Cucurbita maxima]) HSP 1 Score: 247.3 bits (630), Expect = 7.2e-62 Identity = 127/128 (99.22%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: XP_022948639.1 (copper transporter 1-like [Cucurbita moschata]) HSP 1 Score: 246.5 bits (628), Expect = 1.2e-61 Identity = 127/128 (99.22%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: KAG6607279.1 (Copper transporter 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 202.6 bits (514), Expect = 2.0e-48 Identity = 106/107 (99.07%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: KAA0031772.1 (putative Copper transporter [Cucumis melo var. makuwa]) HSP 1 Score: 194.9 bits (494), Expect = 4.3e-46 Identity = 97/130 (74.62%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy Swiss-Prot
Match: Q39065 (Copper transporter 1 OS=Arabidopsis thaliana OX=3702 GN=COPT1 PE=2 SV=2) HSP 1 Score: 132.9 bits (333), Expect = 2.6e-30 Identity = 67/131 (51.15%), Postives = 90/131 (68.70%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy Swiss-Prot
Match: Q9STG2 (Copper transporter 2 OS=Arabidopsis thaliana OX=3702 GN=COPT2 PE=2 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.0e-27 Identity = 60/116 (51.72%), Postives = 82/116 (70.69%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy Swiss-Prot
Match: Q8GWP3 (Copper transporter 6 OS=Arabidopsis thaliana OX=3702 GN=COPT6 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.5e-25 Identity = 59/113 (52.21%), Postives = 79/113 (69.91%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy Swiss-Prot
Match: Q9FGU8 (Copper transporter 3 OS=Arabidopsis thaliana OX=3702 GN=COPT3 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.8e-21 Identity = 52/106 (49.06%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy Swiss-Prot
Match: Q8SAA5 (Copper transporter 4 OS=Arabidopsis thaliana OX=3702 GN=COPT4 PE=2 SV=2) HSP 1 Score: 97.1 bits (240), Expect = 1.6e-19 Identity = 50/114 (43.86%), Postives = 75/114 (65.79%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy TrEMBL
Match: A0A6J1KDT9 (Copper transporter OS=Cucurbita maxima OX=3661 GN=LOC111493433 PE=3 SV=1) HSP 1 Score: 247.3 bits (630), Expect = 3.5e-62 Identity = 127/128 (99.22%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy TrEMBL
Match: A0A6J1GAH5 (Copper transporter OS=Cucurbita moschata OX=3662 GN=LOC111452258 PE=3 SV=1) HSP 1 Score: 246.5 bits (628), Expect = 6.0e-62 Identity = 127/128 (99.22%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy TrEMBL
Match: A0A5A7SL08 (Copper transporter OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold848G00120 PE=3 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 2.1e-46 Identity = 97/130 (74.62%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy TrEMBL
Match: A0A5D3BC00 (Copper transporter OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G001700 PE=3 SV=1) HSP 1 Score: 193.4 bits (490), Expect = 6.0e-46 Identity = 96/130 (73.85%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of Carg12399 vs. ExPASy TrEMBL
Match: A0A0A0LXH5 (Copper transporter OS=Cucumis sativus OX=3659 GN=Csa_1G526835 PE=3 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 3.0e-45 Identity = 94/130 (72.31%), Postives = 109/130 (83.85%), Query Frame = 0
BLAST of Carg12399 vs. TAIR 10
Match: AT5G59030.1 (copper transporter 1 ) HSP 1 Score: 132.9 bits (333), Expect = 1.9e-31 Identity = 67/131 (51.15%), Postives = 90/131 (68.70%), Query Frame = 0
BLAST of Carg12399 vs. TAIR 10
Match: AT3G46900.1 (copper transporter 2 ) HSP 1 Score: 121.7 bits (304), Expect = 4.3e-28 Identity = 60/116 (51.72%), Postives = 82/116 (70.69%), Query Frame = 0
BLAST of Carg12399 vs. TAIR 10
Match: AT2G26975.1 (Ctr copper transporter family ) HSP 1 Score: 116.3 bits (290), Expect = 1.8e-26 Identity = 59/113 (52.21%), Postives = 79/113 (69.91%), Query Frame = 0
BLAST of Carg12399 vs. TAIR 10
Match: AT5G59040.1 (copper transporter 3 ) HSP 1 Score: 102.4 bits (254), Expect = 2.7e-22 Identity = 52/106 (49.06%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Carg12399 vs. TAIR 10
Match: AT2G37925.1 (copper transporter 4 ) HSP 1 Score: 97.1 bits (240), Expect = 1.1e-20 Identity = 50/114 (43.86%), Postives = 75/114 (65.79%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|