Carg11948 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCGGCATCCAATGGAGAAACAACTCCGTCACTCCGCCCAAACCCACCGTCCTAATGGCCTCTCTGTTCTCGTCACCGGCGCTGCTGGCTTCGTCGGAACCCATGTTTCCCTCGCTTTGAAGAACGCGGCGACGGCGTTGTCGGCCTTGATAATTTCAATTCCTATTATGACCCTTCCTTTGAAAAAAAGCCCGGAAATCGCTTCTCTCCGATCCACGGAATCTTCGTCGTTCACGGCGATTAAACGACGCTAG ATGGGGCGGCATCCAATGGAGAAACAACTCCGTCACTCCGCCCAAACCCACCGTCCTAATGGCCTCTCTGTTCTCGTCACCGGCGCTGCTGGCTTCGTCGGAACCCATGTTTCCCTCGCTTTGAAGAACGCGGCGACGGCGTTGTCGGCCTTGATAATTTCAATTCCTATTATGACCCTTCCTTTGAAAAAAAGCCCGGAAATCGCTTCTCTCCGATCCACGGAATCTTCGTCGTTCACGGCGATTAAACGACGCTAG ATGGGGCGGCATCCAATGGAGAAACAACTCCGTCACTCCGCCCAAACCCACCGTCCTAATGGCCTCTCTGTTCTCGTCACCGGCGCTGCTGGCTTCGTCGGAACCCATGTTTCCCTCGCTTTGAAGAACGCGGCGACGGCGTTGTCGGCCTTGATAATTTCAATTCCTATTATGACCCTTCCTTTGAAAAAAAGCCCGGAAATCGCTTCTCTCCGATCCACGGAATCTTCGTCGTTCACGGCGATTAAACGACGCTAG MGRHPMEKQLRHSAQTHRPNGLSVLVTGAAGFVGTHVSLALKNAATALSALIISIPIMTLPLKKSPEIASLRSTESSSFTAIKRR Homology
BLAST of Carg11948 vs. NCBI nr
Match: KAG7030067.1 (UDP-glucuronate 4-epimerase 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 157.5 bits (397), Expect = 5.0e-35 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: XP_023547336.1 (UDP-glucuronate 4-epimerase 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: XP_022999693.1 (UDP-glucuronate 4-epimerase 1 [Cucurbita maxima]) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: XP_022946532.1 (UDP-glucuronate 4-epimerase 1 [Cucurbita moschata]) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: KAG6599128.1 (UDP-glucuronate 4-epimerase 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7030066.1 UDP-glucuronate 4-epimerase 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy Swiss-Prot
Match: Q9M0B6 (UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana OX=3702 GN=GAE1 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.8e-07 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy Swiss-Prot
Match: Q9LIS3 (UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana OX=3702 GN=GAE6 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 5.1e-06 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy Swiss-Prot
Match: Q9LPC1 (UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana OX=3702 GN=GAE2 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-05 Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy Swiss-Prot
Match: Q9STI6 (UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana OX=3702 GN=GAE5 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.6e-05 Identity = 25/45 (55.56%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy Swiss-Prot
Match: O81312 (UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana OX=3702 GN=GAE3 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 9.6e-05 Identity = 26/45 (57.78%), Postives = 30/45 (66.67%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy TrEMBL
Match: A0A6J1KKG5 (UDP-glucuronate 4-epimerase 1 OS=Cucurbita maxima OX=3661 GN=LOC111493970 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 1.3e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy TrEMBL
Match: A0A6J1G3Z3 (UDP-glucuronate 4-epimerase 1 OS=Cucurbita moschata OX=3662 GN=LOC111450569 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 1.3e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy TrEMBL
Match: B9HBG7 (NAD(P)-bd_dom domain-containing protein OS=Populus trichocarpa OX=3694 GN=POPTR_006G178500 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 2.8e-07 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy TrEMBL
Match: A0A6M2EZ64 (NAD(P)-bd_dom domain-containing protein OS=Populus davidiana OX=266767 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 2.8e-07 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 0
BLAST of Carg11948 vs. ExPASy TrEMBL
Match: A0A4V6A9C4 (NAD(P)-bd_dom domain-containing protein OS=Populus alba OX=43335 GN=D5086_0000128950 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 2.8e-07 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 0
BLAST of Carg11948 vs. TAIR 10
Match: AT4G30440.1 (UDP-D-glucuronate 4-epimerase 1 ) HSP 1 Score: 54.3 bits (129), Expect = 5.6e-08 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 0
BLAST of Carg11948 vs. TAIR 10
Match: AT3G23820.1 (UDP-D-glucuronate 4-epimerase 6 ) HSP 1 Score: 51.6 bits (122), Expect = 3.6e-07 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 0
BLAST of Carg11948 vs. TAIR 10
Match: AT1G02000.1 (UDP-D-glucuronate 4-epimerase 2 ) HSP 1 Score: 50.4 bits (119), Expect = 8.0e-07 Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. TAIR 10
Match: AT4G12250.1 (UDP-D-glucuronate 4-epimerase 5 ) HSP 1 Score: 48.1 bits (113), Expect = 4.0e-06 Identity = 25/45 (55.56%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. TAIR 10
Match: AT2G45310.1 (UDP-D-glucuronate 4-epimerase 4 ) HSP 1 Score: 47.4 bits (111), Expect = 6.8e-06 Identity = 28/47 (59.57%), Postives = 33/47 (70.21%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|