![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Carg11122 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CTGAGATCAATTACCTTCTCATGTTGGCTTGTGTTTGTGTTACTTTGGTCTTCAAGAACACTACAAATATCGGCAATGCATACGGTAACTTACTCGTTCAACCTAACTCAACTCAACTCGACCAGCACTGACTAAATAAAGATTTTGCTCTAAACAGGAATAGCAGTGGTGTTTGTGATGACACTCACGTCCTCCTTCCTAGTATTGATAATGGTAATGATATGGAAAACTCACATCCTGTTGGTAATCACTTACGTTGTCATAATTGGGAGCGTGGAATTGGTGTATCTGAGTTCAGTTCTTTACAAGTTCGACCAAGGAGGGTATCTCCCTCTGGCTTTTGCAGCTGTTATGATGACAATA CTGAGATCAATTACCTTCTCATGTTGGCTTGTGTTTGTGTTACTTTGGTCTTCAAGAACACTACAAATATCGGCAATGCATACGGAATAGCAGTGGTGTTTGTGATGACACTCACGTCCTCCTTCCTAGTATTGATAATGGTAATGATATGGAAAACTCACATCCTGTTGGTAATCACTTACGTTGTCATAATTGGGAGCGTGGAATTGGTGTATCTGAGTTCAGTTCTTTACAAGTTCGACCAAGGAGGGTATCTCCCTCTGGCTTTTGCAGCTGTTATGATGACAATA ATGTTGGCTTGTGTTTGTGTTACTTTGGTCTTCAAGAACACTACAAATATCGGCAATGCATACGGAATAGCAGTGGTGTTTGTGATGACACTCACGTCCTCCTTCCTAGTATTGATAATGGTAATGATATGGAAAACTCACATCCTGTTGGTAATCACTTACGTTGTCATAATTGGGAGCGTGGAATTGGTGTATCTGAGTTCAGTTCTTTACAAGTTCGACCAAGGAGGGTATCTCCCTCTGGCTTTTGCAGCTGTTATGATGACAATA MLACVCVTLVFKNTTNIGNAYGIAVVFVMTLTSSFLVLIMVMIWKTHILLVITYVVIIGSVELVYLSSVLYKFDQGGYLPLAFAAVMMTI Homology
BLAST of Carg11122 vs. NCBI nr
Match: KAG7017982.1 (Potassium transporter 5, partial [Cucurbita argyrosperma subsp. argyrosperma] >KAG7017983.1 Potassium transporter 5, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 161.0 bits (406), Expect = 4.8e-36 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Carg11122 vs. NCBI nr
Match: KAG6581252.1 (Potassium transporter 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 161.0 bits (406), Expect = 4.8e-36 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Carg11122 vs. NCBI nr
Match: KAG6581254.1 (Potassium transporter 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 161.0 bits (406), Expect = 4.8e-36 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Carg11122 vs. NCBI nr
Match: XP_022983444.1 (potassium transporter 5-like [Cucurbita maxima]) HSP 1 Score: 159.8 bits (403), Expect = 1.1e-35 Identity = 89/90 (98.89%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Carg11122 vs. NCBI nr
Match: KAG6581255.1 (Potassium transporter 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 159.5 bits (402), Expect = 1.4e-35 Identity = 88/90 (97.78%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy Swiss-Prot
Match: Q5JK32 (Potassium transporter 5 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK5 PE=2 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 3.8e-20 Identity = 53/90 (58.89%), Postives = 67/90 (74.44%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy Swiss-Prot
Match: Q9M7K4 (Potassium transporter 5 OS=Arabidopsis thaliana OX=3702 GN=POT5 PE=1 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.2e-19 Identity = 49/90 (54.44%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy Swiss-Prot
Match: Q6VVA6 (Potassium transporter 1 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK1 PE=1 SV=2) HSP 1 Score: 82.0 bits (201), Expect = 3.7e-15 Identity = 42/89 (47.19%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy Swiss-Prot
Match: Q6H4R6 (Potassium transporter 23 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK23 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.1e-14 Identity = 41/90 (45.56%), Postives = 68/90 (75.56%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy Swiss-Prot
Match: O64769 (Potassium transporter 11 OS=Arabidopsis thaliana OX=3702 GN=POT11 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.4e-14 Identity = 42/90 (46.67%), Postives = 62/90 (68.89%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy TrEMBL
Match: A0A6J1J7D5 (Potassium transporter OS=Cucurbita maxima OX=3661 GN=LOC111482046 PE=3 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 5.2e-36 Identity = 89/90 (98.89%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy TrEMBL
Match: A0A6J1F519 (Potassium transporter OS=Cucurbita moschata OX=3662 GN=LOC111442228 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 6.7e-36 Identity = 88/90 (97.78%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy TrEMBL
Match: A0A6J1F467 (Potassium transporter OS=Cucurbita moschata OX=3662 GN=LOC111442230 PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 8.8e-36 Identity = 89/90 (98.89%), Postives = 89/90 (98.89%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy TrEMBL
Match: A0A6J1HLM3 (Potassium transporter OS=Cucurbita moschata OX=3662 GN=LOC111464714 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 1.7e-34 Identity = 86/90 (95.56%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of Carg11122 vs. ExPASy TrEMBL
Match: A0A7N2N3X4 (Potassium transporter OS=Quercus lobata OX=97700 PE=3 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 3.8e-31 Identity = 78/90 (86.67%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of Carg11122 vs. TAIR 10
Match: AT4G13420.1 (high affinity K+ transporter 5 ) HSP 1 Score: 94.4 bits (233), Expect = 5.1e-20 Identity = 49/90 (54.44%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of Carg11122 vs. TAIR 10
Match: AT2G35060.1 (K+ uptake permease 11 ) HSP 1 Score: 78.2 bits (191), Expect = 3.8e-15 Identity = 42/90 (46.67%), Postives = 62/90 (68.89%), Query Frame = 0
BLAST of Carg11122 vs. TAIR 10
Match: AT2G35060.2 (K+ uptake permease 11 ) HSP 1 Score: 78.2 bits (191), Expect = 3.8e-15 Identity = 42/90 (46.67%), Postives = 62/90 (68.89%), Query Frame = 0
BLAST of Carg11122 vs. TAIR 10
Match: AT1G31120.1 (K+ uptake permease 10 ) HSP 1 Score: 76.3 bits (186), Expect = 1.4e-14 Identity = 41/90 (45.56%), Postives = 62/90 (68.89%), Query Frame = 0
BLAST of Carg11122 vs. TAIR 10
Match: AT4G19960.2 (K+ uptake permease 9 ) HSP 1 Score: 76.3 bits (186), Expect = 1.4e-14 Identity = 41/90 (45.56%), Postives = 62/90 (68.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|