Carg10410 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAAAGGGTGGTGGTGGTGAAGAAATCCGATGGGCCTGGGGGGCGAGGAAACCGGTCTGGTTCGGGCTCGGTCGTGCGCTACGCCGAGTGCCAGAAGAATCACGCGGCGAAGCTCGGTGGGTTCGCGGTGGACGGTTGCCGTGAGTTCATGGCCAGAGGCGAGGAGGGGACTGAGGAGGCTCTCAGCTGCGCTGCTTGTGGCTGCCACCGGAATTTTCATAGAAGAGAGGTGGATGCTGAAGTTGTTTTCGAGTATTCTCCTCCAAACTCCGATCATCATTGA ATGAAGAAAAGGGTGGTGGTGGTGAAGAAATCCGATGGGCCTGGGGGGCGAGGAAACCGGTCTGGTTCGGGCTCGGTCGTGCGCTACGCCGAGTGCCAGAAGAATCACGCGGCGAAGCTCGGTGGGTTCGCGGTGGACGGTTGCCGTGAGTTCATGGCCAGAGGCGAGGAGGGGACTGAGGAGGCTCTCAGCTGCGCTGCTTGTGGCTGCCACCGGAATTTTCATAGAAGAGAGGTGGATGCTGAAGTTGTTTTCGAGTATTCTCCTCCAAACTCCGATCATCATTGA ATGAAGAAAAGGGTGGTGGTGGTGAAGAAATCCGATGGGCCTGGGGGGCGAGGAAACCGGTCTGGTTCGGGCTCGGTCGTGCGCTACGCCGAGTGCCAGAAGAATCACGCGGCGAAGCTCGGTGGGTTCGCGGTGGACGGTTGCCGTGAGTTCATGGCCAGAGGCGAGGAGGGGACTGAGGAGGCTCTCAGCTGCGCTGCTTGTGGCTGCCACCGGAATTTTCATAGAAGAGAGGTGGATGCTGAAGTTGTTTTCGAGTATTCTCCTCCAAACTCCGATCATCATTGA MKKRVVVVKKSDGPGGRGNRSGSGSVVRYAECQKNHAAKLGGFAVDGCREFMARGEEGTEEALSCAACGCHRNFHRREVDAEVVFEYSPPNSDHH Homology
BLAST of Carg10410 vs. NCBI nr
Match: KAG7023191.1 (Mini zinc finger protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 200.7 bits (509), Expect = 5.8e-48 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of Carg10410 vs. NCBI nr
Match: XP_022921765.1 (mini zinc finger protein 3-like [Cucurbita moschata] >KAG6589505.1 Mini zinc finger protein 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 197.6 bits (501), Expect = 4.9e-47 Identity = 94/95 (98.95%), Postives = 94/95 (98.95%), Query Frame = 0
BLAST of Carg10410 vs. NCBI nr
Match: XP_022987207.1 (mini zinc finger protein 3-like [Cucurbita maxima]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 93/95 (97.89%), Postives = 94/95 (98.95%), Query Frame = 0
BLAST of Carg10410 vs. NCBI nr
Match: XP_023516615.1 (mini zinc finger protein 3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 194.5 bits (493), Expect = 4.1e-46 Identity = 93/95 (97.89%), Postives = 93/95 (97.89%), Query Frame = 0
BLAST of Carg10410 vs. NCBI nr
Match: XP_022135253.1 (mini zinc finger protein 3-like [Momordica charantia]) HSP 1 Score: 175.6 bits (444), Expect = 2.0e-40 Identity = 85/94 (90.43%), Postives = 89/94 (94.68%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy Swiss-Prot
Match: Q9CA51 (Mini zinc finger protein 1 OS=Arabidopsis thaliana OX=3702 GN=MIF1 PE=1 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.6e-27 Identity = 62/101 (61.39%), Postives = 71/101 (70.30%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy Swiss-Prot
Match: Q2Q493 (Mini zinc finger protein 3 OS=Arabidopsis thaliana OX=3702 GN=MIF3 PE=1 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 9.9e-27 Identity = 60/94 (63.83%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy Swiss-Prot
Match: Q9LJW5 (Mini zinc finger protein 2 OS=Arabidopsis thaliana OX=3702 GN=MIF2 PE=1 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-23 Identity = 57/97 (58.76%), Postives = 74/97 (76.29%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy Swiss-Prot
Match: Q9SB61 (Zinc-finger homeodomain protein 2 OS=Arabidopsis thaliana OX=3702 GN=ZHD1 PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.8e-20 Identity = 44/71 (61.97%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy Swiss-Prot
Match: B8BIU8 (Mini zinc finger protein 1 OS=Oryza sativa subsp. indica OX=39946 GN=MIF1 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.4e-20 Identity = 46/71 (64.79%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy TrEMBL
Match: A0A6J1E6Q9 (mini zinc finger protein 3-like OS=Cucurbita moschata OX=3662 GN=LOC111429921 PE=4 SV=1) HSP 1 Score: 197.6 bits (501), Expect = 2.4e-47 Identity = 94/95 (98.95%), Postives = 94/95 (98.95%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy TrEMBL
Match: A0A6J1J9R5 (mini zinc finger protein 3-like OS=Cucurbita maxima OX=3661 GN=LOC111484829 PE=4 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 5.3e-47 Identity = 93/95 (97.89%), Postives = 94/95 (98.95%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy TrEMBL
Match: A0A6J1C4B2 (mini zinc finger protein 3-like OS=Momordica charantia OX=3673 GN=LOC111007261 PE=4 SV=1) HSP 1 Score: 175.6 bits (444), Expect = 9.6e-41 Identity = 85/94 (90.43%), Postives = 89/94 (94.68%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy TrEMBL
Match: A0A0A0LSA6 (ZF-HD dimerization-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G009710 PE=4 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.2e-38 Identity = 82/95 (86.32%), Postives = 87/95 (91.58%), Query Frame = 0
BLAST of Carg10410 vs. ExPASy TrEMBL
Match: A0A5A7UWS7 (Mini zinc finger protein 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G002440 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.5e-38 Identity = 82/96 (85.42%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of Carg10410 vs. TAIR 10
Match: AT1G74660.1 (mini zinc finger 1 ) HSP 1 Score: 122.5 bits (306), Expect = 1.9e-28 Identity = 62/101 (61.39%), Postives = 71/101 (70.30%), Query Frame = 0
BLAST of Carg10410 vs. TAIR 10
Match: AT1G18835.1 (mini zinc finger ) HSP 1 Score: 120.6 bits (301), Expect = 7.1e-28 Identity = 60/94 (63.83%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of Carg10410 vs. TAIR 10
Match: AT3G28917.1 (mini zinc finger 2 ) HSP 1 Score: 110.5 bits (275), Expect = 7.3e-25 Identity = 57/97 (58.76%), Postives = 74/97 (76.29%), Query Frame = 0
BLAST of Carg10410 vs. TAIR 10
Match: AT4G24660.1 (homeobox protein 22 ) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-21 Identity = 44/71 (61.97%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of Carg10410 vs. TAIR 10
Match: AT2G02540.1 (homeobox protein 21 ) HSP 1 Score: 92.4 bits (228), Expect = 2.1e-19 Identity = 40/69 (57.97%), Postives = 50/69 (72.46%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|