Carg08677 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CAAGACCCCATCTCAACCAAAAAATATATTTACCTAACTTCTTAGATTTCTTCACTGTATTCCCTTTCCACAACCCCCTATAAACAGACACCTCTTGCATAACCAATACCCCATCCAGATTTCTAATGGCAGCAACTAAAGGTCTTGTGTTTGCTATGCTTCTTATTGCTTTTGCTTTTGTGCTCCTTATGGAATCAGCCCAAATGGTAATCCTTCTTCCATTTTATTTCTCTGTTCATTTCTGATACTCTCAACTTTGTGGCCTTATTACCTCACTGTATTGTGTCCTTTCAGGTTATCACAACTCAGGTTGATAGCCCTCTTCCTGGCGAGATAGGTAACAGAGAGATTTGAGCACCTGCACCCACATTGTTATGTTAATGCTTCTTGCTTCCTGACCAATACCTGAATCTATTGCAGATTGTGGAGAATCTTGTGATGCGAGATGCCAATTATCGTCGAGGCAAAAGATCTGCAAGAGGGCATGTGGAACCTGCTGCGCTCGCTGTCAATGCGTTCCACCAGGCACTTCAGGCAACTATGATGTTTGTCCCTGCTATGCTAACATGACTACACATGGTGGCAGGCACAAGTGTCCCTAG CAAGACCCCATCTCAACCAAAAAATATATTTACCTAACTTCTTAGATTTCTTCACTGTATTCCCTTTCCACAACCCCCTATAAACAGACACCTCTTGCATAACCAATACCCCATCCAGATTTCTAATGGCAGCAACTAAAGGTCTTGTGTTTGCTATGCTTCTTATTGCTTTTGCTTTTGTGCTCCTTATGGAATCAGCCCAAATGGTTATCACAACTCAGGTTGATAGCCCTCTTCCTGGCGAGATAGATTGTGGAGAATCTTGTGATGCGAGATGCCAATTATCGTCGAGGCAAAAGATCTGCAAGAGGGCATGTGGAACCTGCTGCGCTCGCTGTCAATGCGTTCCACCAGGCACTTCAGGCAACTATGATGTTTGTCCCTGCTATGCTAACATGACTACACATGGTGGCAGGCACAAGTGTCCCTAG ATGGCAGCAACTAAAGGTCTTGTGTTTGCTATGCTTCTTATTGCTTTTGCTTTTGTGCTCCTTATGGAATCAGCCCAAATGGTTATCACAACTCAGGTTGATAGCCCTCTTCCTGGCGAGATAGATTGTGGAGAATCTTGTGATGCGAGATGCCAATTATCGTCGAGGCAAAAGATCTGCAAGAGGGCATGTGGAACCTGCTGCGCTCGCTGTCAATGCGTTCCACCAGGCACTTCAGGCAACTATGATGTTTGTCCCTGCTATGCTAACATGACTACACATGGTGGCAGGCACAAGTGTCCCTAG MAATKGLVFAMLLIAFAFVLLMESAQMVITTQVDSPLPGEIDCGESCDARCQLSSRQKICKRACGTCCARCQCVPPGTSGNYDVCPCYANMTTHGGRHKCP Homology
BLAST of Carg08677 vs. NCBI nr
Match: KAG6591269.1 (Snakin-2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7024153.1 Snakin-2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 210.3 bits (534), Expect = 7.7e-51 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Carg08677 vs. NCBI nr
Match: XP_023535343.1 (gibberellin-regulated protein 11-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 206.1 bits (523), Expect = 1.5e-49 Identity = 98/101 (97.03%), Postives = 100/101 (99.01%), Query Frame = 0
BLAST of Carg08677 vs. NCBI nr
Match: XP_022975660.1 (snakin-2-like [Cucurbita maxima]) HSP 1 Score: 204.1 bits (518), Expect = 5.5e-49 Identity = 98/101 (97.03%), Postives = 99/101 (98.02%), Query Frame = 0
BLAST of Carg08677 vs. NCBI nr
Match: XP_022937106.1 (gibberellin-regulated protein 1-like [Cucurbita moschata]) HSP 1 Score: 201.8 bits (512), Expect = 2.7e-48 Identity = 97/101 (96.04%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Carg08677 vs. NCBI nr
Match: XP_008466485.1 (PREDICTED: gibberellin-regulated protein 1-like [Cucumis melo] >KAA0063283.1 gibberellin-regulated protein 1-like [Cucumis melo var. makuwa] >TYK31492.1 gibberellin-regulated protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 190.3 bits (482), Expect = 8.3e-45 Identity = 91/101 (90.10%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy Swiss-Prot
Match: Q93X17 (Snakin-2 OS=Solanum tuberosum OX=4113 GN=SN2 PE=1 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-25 Identity = 61/108 (56.48%), Postives = 75/108 (69.44%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy Swiss-Prot
Match: P46689 (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana OX=3702 GN=GASA1 PE=2 SV=2) HSP 1 Score: 108.6 bits (270), Expect = 4.2e-23 Identity = 55/101 (54.46%), Postives = 71/101 (70.30%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy Swiss-Prot
Match: F4IQJ4 (Gibberellin-regulated protein 11 OS=Arabidopsis thaliana OX=3702 GN=GASA11 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 9.2e-23 Identity = 52/95 (54.74%), Postives = 64/95 (67.37%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy Swiss-Prot
Match: Q8GWK5 (Gibberellin-regulated protein 9 OS=Arabidopsis thaliana OX=3702 GN=GASA9 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 9.6e-20 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy Swiss-Prot
Match: P46688 (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana OX=3702 GN=GASA2 PE=2 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.6e-19 Identity = 48/98 (48.98%), Postives = 62/98 (63.27%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy TrEMBL
Match: A0A6J1IHC1 (snakin-2-like OS=Cucurbita maxima OX=3661 GN=LOC111475493 PE=3 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 2.7e-49 Identity = 98/101 (97.03%), Postives = 99/101 (98.02%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy TrEMBL
Match: A0A6J1F9F4 (gibberellin-regulated protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111443509 PE=3 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 1.3e-48 Identity = 97/101 (96.04%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy TrEMBL
Match: A0A5A7V5C1 (Gibberellin-regulated protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G008080 PE=3 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 4.0e-45 Identity = 91/101 (90.10%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy TrEMBL
Match: A0A1S3CRE3 (gibberellin-regulated protein 1-like OS=Cucumis melo OX=3656 GN=LOC103503877 PE=3 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 4.0e-45 Identity = 91/101 (90.10%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Carg08677 vs. ExPASy TrEMBL
Match: A0A0A0LGH8 (Gibberellin-regulated protein 1 OS=Cucumis sativus OX=3659 GN=Csa_3G872160 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 2.9e-43 Identity = 87/101 (86.14%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of Carg08677 vs. TAIR 10
Match: AT1G75750.2 (GAST1 protein homolog 1 ) HSP 1 Score: 109.4 bits (272), Expect = 1.7e-24 Identity = 52/101 (51.49%), Postives = 70/101 (69.31%), Query Frame = 0
BLAST of Carg08677 vs. TAIR 10
Match: AT1G75750.1 (GAST1 protein homolog 1 ) HSP 1 Score: 108.6 bits (270), Expect = 2.9e-24 Identity = 55/101 (54.46%), Postives = 71/101 (70.30%), Query Frame = 0
BLAST of Carg08677 vs. TAIR 10
Match: AT2G18420.1 (Gibberellin-regulated family protein ) HSP 1 Score: 107.5 bits (267), Expect = 6.6e-24 Identity = 52/95 (54.74%), Postives = 64/95 (67.37%), Query Frame = 0
BLAST of Carg08677 vs. TAIR 10
Match: AT1G22690.1 (Gibberellin-regulated family protein ) HSP 1 Score: 97.4 bits (241), Expect = 6.8e-21 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of Carg08677 vs. TAIR 10
Match: AT1G22690.2 (Gibberellin-regulated family protein ) HSP 1 Score: 97.4 bits (241), Expect = 6.8e-21 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|