Carg04602 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGGAGGACAAGCGGAACATTCTTGACCATTATCGTCGACAGCTAGCTGCGAAGTTTGAGTTGAAGCGGAAGCTTTTCAAAGCCGTTTGCAATGATCCGAGTCTTCCCAACGATGTGCGAGAAGAGCATCGTTATAAGCTGTCGAAATTGCCAAGGAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATCTTCACCGGTCGACCTAGGGGTGTCTATCAGCTTTTCCGTGTTTCTCGTATCGTCTTCCGTGATCTGGCATCCAAAGGTCTTATTATGGGTGTCAAGAAATCTTCTTGGTAG ATGACGGAGGACAAGCGGAACATTCTTGACCATTATCGTCGACAGCTAGCTGCGAAGTTTGAGTTGAAGCGGAAGCTTTTCAAAGCCGTTTGCAATGATCCGAGTCTTCCCAACGATGTGCGAGAAGAGCATCGTTATAAGCTGTCGAAATTGCCAAGGAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATCTTCACCGGTCGACCTAGGGGTGTCTATCAGCTTTTCCGTGTTTCTCGTATCGTCTTCCGTGATCTGGCATCCAAAGGTCTTATTATGGGTGTCAAGAAATCTTCTTGGTAG ATGACGGAGGACAAGCGGAACATTCTTGACCATTATCGTCGACAGCTAGCTGCGAAGTTTGAGTTGAAGCGGAAGCTTTTCAAAGCCGTTTGCAATGATCCGAGTCTTCCCAACGATGTGCGAGAAGAGCATCGTTATAAGCTGTCGAAATTGCCAAGGAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATCTTCACCGGTCGACCTAGGGGTGTCTATCAGCTTTTCCGTGTTTCTCGTATCGTCTTCCGTGATCTGGCATCCAAAGGTCTTATTATGGGTGTCAAGAAATCTTCTTGGTAG MTEDKRNILDHYRRQLAAKFELKRKLFKAVCNDPSLPNDVREEHRYKLSKLPRNSSFTRLRNRCIFTGRPRGVYQLFRVSRIVFRDLASKGLIMGVKKSSW Homology
BLAST of Carg04602 vs. NCBI nr
Match: KAG7032953.1 (Ribosomal protein S14, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 206.5 bits (524), Expect = 1.1e-49 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Carg04602 vs. NCBI nr
Match: XP_022938933.1 (uncharacterized protein LOC111444996 [Cucurbita moschata] >XP_022938934.1 uncharacterized protein LOC111444996 [Cucurbita moschata] >KAG7016311.1 Ribosomal protein S14, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 205.3 bits (521), Expect = 2.5e-49 Identity = 100/101 (99.01%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Carg04602 vs. NCBI nr
Match: XP_023550870.1 (uncharacterized protein LOC111808878 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 204.9 bits (520), Expect = 3.2e-49 Identity = 99/101 (98.02%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Carg04602 vs. NCBI nr
Match: XP_038884392.1 (ribosomal protein S14, mitochondrial [Benincasa hispida]) HSP 1 Score: 198.7 bits (504), Expect = 2.3e-47 Identity = 95/101 (94.06%), Postives = 100/101 (99.01%), Query Frame = 0
BLAST of Carg04602 vs. NCBI nr
Match: XP_022134507.1 (uncharacterized protein LOC111006733 [Momordica charantia] >XP_022134508.1 uncharacterized protein LOC111006733 [Momordica charantia]) HSP 1 Score: 195.7 bits (496), Expect = 2.0e-46 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy Swiss-Prot
Match: P14875 (Ribosomal protein S14, mitochondrial OS=Oenothera berteroana OX=3950 GN=RPS14 PE=3 SV=2) HSP 1 Score: 157.5 bits (397), Expect = 7.8e-38 Identity = 72/98 (73.47%), Postives = 87/98 (88.78%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy Swiss-Prot
Match: P05716 (Ribosomal protein S14, mitochondrial OS=Vicia faba OX=3906 GN=RPS14 PE=3 SV=2) HSP 1 Score: 151.0 bits (380), Expect = 7.3e-36 Identity = 71/98 (72.45%), Postives = 85/98 (86.73%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy Swiss-Prot
Match: P49387 (Ribosomal protein S14, mitochondrial OS=Brassica napus OX=3708 GN=RPS14 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 4.7e-35 Identity = 69/98 (70.41%), Postives = 83/98 (84.69%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy Swiss-Prot
Match: P26873 (Ribosomal protein S14, mitochondrial OS=Marchantia polymorpha OX=3197 GN=RPS14 PE=3 SV=2) HSP 1 Score: 136.0 bits (341), Expect = 2.4e-31 Identity = 64/94 (68.09%), Postives = 78/94 (82.98%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy Swiss-Prot
Match: P46752 (Ribosomal protein S14, mitochondrial OS=Prototheca wickerhamii OX=3111 GN=RPS14 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.2e-19 Identity = 51/92 (55.43%), Postives = 65/92 (70.65%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy TrEMBL
Match: A0A6J1FKA4 (uncharacterized protein LOC111444996 OS=Cucurbita moschata OX=3662 GN=LOC111444996 PE=3 SV=1) HSP 1 Score: 205.3 bits (521), Expect = 1.2e-49 Identity = 100/101 (99.01%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy TrEMBL
Match: A0A6J1C264 (uncharacterized protein LOC111006733 OS=Momordica charantia OX=3673 GN=LOC111006733 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.5e-47 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy TrEMBL
Match: A0A5D3CKB3 (Ribosomal protein S14 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold304G00590 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 2.0e-44 Identity = 89/101 (88.12%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy TrEMBL
Match: A0A1S4E169 (ribosomal protein S14, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103496488 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 2.0e-44 Identity = 89/101 (88.12%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Carg04602 vs. ExPASy TrEMBL
Match: A0A0A0LSR8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G386130 PE=3 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 1.3e-43 Identity = 88/101 (87.13%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of Carg04602 vs. TAIR 10
Match: AT2G34520.1 (mitochondrial ribosomal protein S14 ) HSP 1 Score: 146.0 bits (367), Expect = 1.7e-35 Identity = 68/97 (70.10%), Postives = 83/97 (85.57%), Query Frame = 0
BLAST of Carg04602 vs. TAIR 10
Match: ATCG00330.1 (chloroplast ribosomal protein S14 ) HSP 1 Score: 54.3 bits (129), Expect = 6.6e-08 Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|