![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Carg04420 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TAACAGAGCATTTCCCCACTAAACTTTCTACTCTGCAATAAAGTCGCCATGGCGGGAAGTTACTTTATGGAAGGCGTTCTGCCATTTCCGGCGATGGTAACCATGGAGTGCATCAACGTCGGTCTCAACACTCTTTTCAAAGCCGCCACCGCCTCCGGCATGAGCCACCACGTCTTCATCGTTTATTCTTACTCCCTCGCAGCCTTCTTCCTCCTCCCTTCTCCCTTCATCTCTCGCAGGTCTTCTTCTCTCTCTTTCTCGATTAATTCTTTCTTTCTTTCTCTCTTTCGATCAAGTAATTTTTAGATTTTGATTTTGTAGATCCACGCGGCTTCCACCGCTCAATTTCTCTATACTCTCCAAGATCGCTCTTCTCGGACTCATCGGGTGCTCCATCTCTGTGACCTAA TAACAGAGCATTTCCCCACTAAACTTTCTACTCTGCAATAAAGTCGCCATGGCGGGAAGTTACTTTATGGAAGGCGTTCTGCCATTTCCGGCGATGGTAACCATGGAGTGCATCAACGTCGGTCTCAACACTCTTTTCAAAGCCGCCACCGCCTCCGGCATGAGCCACCACGTCTTCATCGTTTATTCTTACTCCCTCGCAGCCTTCTTCCTCCTCCCTTCTCCCTTCATCTCTCGCAGATCCACGCGGCTTCCACCGCTCAATTTCTCTATACTCTCCAAGATCGCTCTTCTCGGACTCATCGGGTGCTCCATCTCTGTGACCTAA ATGGCGGGAAGTTACTTTATGGAAGGCGTTCTGCCATTTCCGGCGATGGTAACCATGGAGTGCATCAACGTCGGTCTCAACACTCTTTTCAAAGCCGCCACCGCCTCCGGCATGAGCCACCACGTCTTCATCGTTTATTCTTACTCCCTCGCAGCCTTCTTCCTCCTCCCTTCTCCCTTCATCTCTCGCAGATCCACGCGGCTTCCACCGCTCAATTTCTCTATACTCTCCAAGATCGCTCTTCTCGGACTCATCGGGTGCTCCATCTCTGTGACCTAA MAGSYFMEGVLPFPAMVTMECINVGLNTLFKAATASGMSHHVFIVYSYSLAAFFLLPSPFISRRSTRLPPLNFSILSKIALLGLIGCSISVT Homology
BLAST of Carg04420 vs. NCBI nr
Match: KAG7033133.1 (WAT1-related protein [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 179.1 bits (453), Expect = 1.7e-41 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Carg04420 vs. NCBI nr
Match: XP_023525248.1 (WAT1-related protein At3g28050-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 168.3 bits (425), Expect = 3.1e-38 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Carg04420 vs. NCBI nr
Match: XP_022952973.1 (WAT1-related protein At3g28050-like [Cucurbita moschata]) HSP 1 Score: 168.3 bits (425), Expect = 3.1e-38 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Carg04420 vs. NCBI nr
Match: KAG6602450.1 (WAT1-related protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 168.3 bits (425), Expect = 3.1e-38 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Carg04420 vs. NCBI nr
Match: XP_022990946.1 (WAT1-related protein At3g28050-like [Cucurbita maxima]) HSP 1 Score: 168.3 bits (425), Expect = 3.1e-38 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy Swiss-Prot
Match: Q94JU2 (WAT1-related protein At3g28050 OS=Arabidopsis thaliana OX=3702 GN=At3g28050 PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.4e-25 Identity = 62/91 (68.13%), Postives = 67/91 (73.63%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy Swiss-Prot
Match: F4KHA8 (WAT1-related protein At5g40230 OS=Arabidopsis thaliana OX=3702 GN=At5g40230 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 8.4e-15 Identity = 43/86 (50.00%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy Swiss-Prot
Match: Q9FL08 (WAT1-related protein At5g40240 OS=Arabidopsis thaliana OX=3702 GN=At5g40240 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-14 Identity = 43/86 (50.00%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy Swiss-Prot
Match: Q9LRS5 (WAT1-related protein At3g28100 OS=Arabidopsis thaliana OX=3702 GN=At3g28100 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.9e-13 Identity = 41/78 (52.56%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy Swiss-Prot
Match: Q8VYZ7 (WAT1-related protein At3g28070 OS=Arabidopsis thaliana OX=3702 GN=At3g28070 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.0e-12 Identity = 40/78 (51.28%), Postives = 55/78 (70.51%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy TrEMBL
Match: A0A6J1JPC9 (WAT1-related protein OS=Cucurbita maxima OX=3661 GN=LOC111487684 PE=3 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.5e-38 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy TrEMBL
Match: A0A6J1GM35 (WAT1-related protein OS=Cucurbita moschata OX=3662 GN=LOC111455487 PE=3 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.5e-38 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy TrEMBL
Match: A0A6J1BVA7 (WAT1-related protein OS=Momordica charantia OX=3673 GN=LOC111006027 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 1.9e-33 Identity = 77/91 (84.62%), Postives = 83/91 (91.21%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy TrEMBL
Match: A0A6J1FI76 (WAT1-related protein OS=Cucurbita moschata OX=3662 GN=LOC111445562 PE=3 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 2.7e-32 Identity = 73/90 (81.11%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of Carg04420 vs. ExPASy TrEMBL
Match: A0A5A7T283 (WAT1-related protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold808G00480 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 7.9e-32 Identity = 74/89 (83.15%), Postives = 80/89 (89.89%), Query Frame = 0
BLAST of Carg04420 vs. TAIR 10
Match: AT3G28050.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 116.7 bits (291), Expect = 9.9e-27 Identity = 62/91 (68.13%), Postives = 67/91 (73.63%), Query Frame = 0
BLAST of Carg04420 vs. TAIR 10
Match: AT5G40230.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 80.9 bits (198), Expect = 6.0e-16 Identity = 43/86 (50.00%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of Carg04420 vs. TAIR 10
Match: AT5G40240.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-15 Identity = 43/86 (50.00%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Carg04420 vs. TAIR 10
Match: AT5G40240.2 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-15 Identity = 43/86 (50.00%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Carg04420 vs. TAIR 10
Match: AT3G28100.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 74.3 bits (181), Expect = 5.6e-14 Identity = 41/78 (52.56%), Postives = 54/78 (69.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|