Carg02444 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TCACAATGCCTTCTACTTCTCTCTCTTTCTGGGGCTAAGATTTTGACCCCCAATGACTGCAGGTACCTAGTTCCAGCGGACCTTACCGTGGGACAGTTTGTTTATGTCATCCGTAAAAGAATCAAATTGAGCCCAGAGAAAGCAATATTTATATTTGTGGACAACGTCCTCCCTCCTACAGGTACACCCTTTTTGTCTATAATGTATGTAGGACATGTTTAGGACCAGTTTTGAAAATGAAAGTCCATCTCATAAACAAGTTCGTTTAAGAGATTTCGAAAATTATTAGTGATTATATCGGTTTTTGCAACCAAAGCTTAAAACACAAGTATGAAACGCAAGAATCAAGATCTTTAGAACTTGTTATTATCCAACTTTGCCAAGCAAATCATTTCTTTTTTCCATCTTAAGGAGCAATCATGTCTGCAATATATGAAGAGAAGAAGGACGAAGATGGATTTCTGTAT TCACAATGCCTTCTACTTCTCTCTCTTTCTGGGGCTAAGATTTTGACCCCCAATGACTGCAGGTACCTAGTTCCAGCGGACCTTACCGTGGGACAGTTTGTTTATGTCATCCGTAAAAGAATCAAATTGAGCCCAGAGAAAGCAATATTTATATTTGTGGACAACGTCCTCCCTCCTACAGGAGCAATCATGTCTGCAATATATGAAGAGAAGAAGGACGAAGATGGATTTCTGTAT TCACAATGCCTTCTACTTCTCTCTCTTTCTGGGGCTAAGATTTTGACCCCCAATGACTGCAGGTACCTAGTTCCAGCGGACCTTACCGTGGGACAGTTTGTTTATGTCATCCGTAAAAGAATCAAATTGAGCCCAGAGAAAGCAATATTTATATTTGTGGACAACGTCCTCCCTCCTACAGGAGCAATCATGTCTGCAATATATGAAGAGAAGAAGGACGAAGATGGATTTCTGTAT SQCLLLLSLSGAKILTPNDCRYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDNVLPPTGAIMSAIYEEKKDEDGFLY Homology
BLAST of Carg02444 vs. NCBI nr
Match: KAG7036126.1 (apg-6, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 160.2 bits (404), Expect = 7.2e-36 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of Carg02444 vs. NCBI nr
Match: RYR58668.1 (hypothetical protein Ahy_A05g024559 isoform A [Arachis hypogaea] >RYR58669.1 hypothetical protein Ahy_A05g024559 isoform B [Arachis hypogaea]) HSP 1 Score: 124.0 bits (310), Expect = 5.7e-25 Identity = 59/62 (95.16%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of Carg02444 vs. NCBI nr
Match: RZB78086.1 (Autophagy-related protein 8f isoform C [Glycine soja]) HSP 1 Score: 122.9 bits (307), Expect = 1.3e-24 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of Carg02444 vs. NCBI nr
Match: XP_028796824.1 (autophagy-related protein 8B-like [Prosopis alba]) HSP 1 Score: 122.1 bits (305), Expect = 2.2e-24 Identity = 57/70 (81.43%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of Carg02444 vs. NCBI nr
Match: XP_042504725.1 (autophagy-related protein 8f-like isoform X1 [Macadamia integrifolia] >XP_042504726.1 autophagy-related protein 8f-like isoform X1 [Macadamia integrifolia] >XP_042504727.1 autophagy-related protein 8f-like isoform X1 [Macadamia integrifolia] >XP_042504728.1 autophagy-related protein 8f-like isoform X1 [Macadamia integrifolia]) HSP 1 Score: 121.3 bits (303), Expect = 3.7e-24 Identity = 58/61 (95.08%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy Swiss-Prot
Match: A1CQS1 (Autophagy-related protein 8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) OX=344612 GN=atg8 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.2e-24 Identity = 55/66 (83.33%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy Swiss-Prot
Match: Q4WJ27 (Autophagy-related protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg8 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.2e-24 Identity = 55/66 (83.33%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy Swiss-Prot
Match: A2QPN1 (Autophagy-related protein 8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg8 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.2e-24 Identity = 55/66 (83.33%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy Swiss-Prot
Match: Q2UBH5 (Autophagy-related protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg8 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.2e-24 Identity = 55/66 (83.33%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy Swiss-Prot
Match: Q0C804 (Autophagy-related protein 8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg8 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.2e-24 Identity = 55/66 (83.33%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy TrEMBL
Match: A0A445D680 (Autophagy-related protein OS=Arachis hypogaea OX=3818 GN=Ahy_A05g024559 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 2.8e-25 Identity = 59/62 (95.16%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy TrEMBL
Match: I1LGN8 (Autophagy-related protein OS=Glycine max OX=3847 GN=100781703 PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 6.1e-25 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy TrEMBL
Match: A0A445HWF4 (Autophagy-related protein OS=Glycine soja OX=3848 GN=D0Y65_028839 PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 6.1e-25 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy TrEMBL
Match: A0A6J1DKS3 (Autophagy-related protein OS=Momordica charantia OX=3673 GN=LOC111021994 PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 4.0e-24 Identity = 58/59 (98.31%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of Carg02444 vs. ExPASy TrEMBL
Match: A0A6J1K978 (Autophagy-related protein OS=Cucurbita maxima OX=3661 GN=LOC111491258 PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 4.0e-24 Identity = 58/59 (98.31%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of Carg02444 vs. TAIR 10
Match: AT2G05630.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 112.1 bits (279), Expect = 2.1e-25 Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of Carg02444 vs. TAIR 10
Match: AT2G05630.2 (Ubiquitin-like superfamily protein ) HSP 1 Score: 112.1 bits (279), Expect = 2.1e-25 Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of Carg02444 vs. TAIR 10
Match: AT4G16520.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 111.7 bits (278), Expect = 2.7e-25 Identity = 52/59 (88.14%), Postives = 57/59 (96.61%), Query Frame = 0
BLAST of Carg02444 vs. TAIR 10
Match: AT4G16520.2 (Ubiquitin-like superfamily protein ) HSP 1 Score: 111.7 bits (278), Expect = 2.7e-25 Identity = 52/59 (88.14%), Postives = 57/59 (96.61%), Query Frame = 0
BLAST of Carg02444 vs. TAIR 10
Match: AT2G45170.1 (AUTOPHAGY 8E ) HSP 1 Score: 110.5 bits (275), Expect = 6.1e-25 Identity = 51/59 (86.44%), Postives = 57/59 (96.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|