CaUC09G170680 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTACCATCGTAAGTTTATCTTCTTGTAATATTTTGGTTGAGTTCATCTTCCTTTTTAAATATACTTTTAATCTTAACTACTTAACAAATTCTTTTTTTTTCTTTCTTCTTTTTCTGCATATGTTGGAGAAAAGTGAAATCGTGGCCTGCACTGATCTTCATGAATGCAGACACGGTTGCAAATATCATCAAGAAAGAACATCCTGACTTTCAGATGATCAAAGTGCTGGCAGGAACTCCAGTAACAAAGGATCTTAAACATGGTCGAGTTCGATTATTTATAAATGTAAAGGAAGATGTGGTTGAAATTCCTCAAGAGGGCTAA ATGTCTTACCATCTGAAATCGTGGCCTGCACTGATCTTCATGAATGCAGACACGGTTGCAAATATCATCAAGAAAGAACATCCTGACTTTCAGATGATCAAAGTGCTGGCAGGAACTCCAGTAACAAAGGATCTTAAACATGGTCGAGTTCGATTATTTATAAATGTAAAGGAAGATGTGGTTGAAATTCCTCAAGAGGGCTAA ATGTCTTACCATCTGAAATCGTGGCCTGCACTGATCTTCATGAATGCAGACACGGTTGCAAATATCATCAAGAAAGAACATCCTGACTTTCAGATGATCAAAGTGCTGGCAGGAACTCCAGTAACAAAGGATCTTAAACATGGTCGAGTTCGATTATTTATAAATGTAAAGGAAGATGTGGTTGAAATTCCTCAAGAGGGCTAA MSYHLKSWPALIFMNADTVANIIKKEHPDFQMIKVLAGTPVTKDLKHGRVRLFINVKEDVVEIPQEG Homology
BLAST of CaUC09G170680 vs. NCBI nr
Match: KGN60477.1 (hypothetical protein Csa_001998 [Cucumis sativus]) HSP 1 Score: 101.7 bits (252), Expect = 2.6e-18 Identity = 48/65 (73.85%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of CaUC09G170680 vs. NCBI nr
Match: KAG6571807.1 (hypothetical protein SDJN03_28535, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 99.4 bits (246), Expect = 1.3e-17 Identity = 45/67 (67.16%), Postives = 56/67 (83.58%), Query Frame = 0
BLAST of CaUC09G170680 vs. NCBI nr
Match: KGN60478.1 (hypothetical protein Csa_001396 [Cucumis sativus]) HSP 1 Score: 82.4 bits (202), Expect = 1.6e-12 Identity = 37/65 (56.92%), Postives = 50/65 (76.92%), Query Frame = 0
BLAST of CaUC09G170680 vs. NCBI nr
Match: XP_011654473.1 (inhibitor of trypsin and hageman factor [Cucumis sativus] >KGN49621.1 hypothetical protein Csa_018430 [Cucumis sativus]) HSP 1 Score: 67.8 bits (164), Expect = 4.1e-08 Identity = 26/61 (42.62%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of CaUC09G170680 vs. NCBI nr
Match: XP_006490176.1 (inhibitor of trypsin and hageman factor-like [Citrus sinensis]) HSP 1 Score: 61.6 bits (148), Expect = 2.9e-06 Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy Swiss-Prot
Match: Q03199 (Proteinase inhibitor I-B OS=Nicotiana tabacum OX=4097 GN=TIMPA PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.3e-08 Identity = 30/61 (49.18%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.2e-07 Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 3.6e-07 Identity = 29/63 (46.03%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy Swiss-Prot
Match: Q03198 (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.2e-07 Identity = 27/61 (44.26%), Postives = 39/61 (63.93%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 8.0e-07 Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy TrEMBL
Match: A0A0A0LIF6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914570 PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.2e-18 Identity = 48/65 (73.85%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy TrEMBL
Match: A0A0A0LFD4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914580 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 7.8e-13 Identity = 37/65 (56.92%), Postives = 50/65 (76.92%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy TrEMBL
Match: A0A0A0KPI0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G027950 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 2.0e-08 Identity = 26/61 (42.62%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy TrEMBL
Match: Q8GT64 (Type I proteinase inhibitor-like protein OS=Citrus paradisi OX=37656 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.4e-06 Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of CaUC09G170680 vs. ExPASy TrEMBL
Match: A0A067E312 (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g033055mg PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 3.2e-06 Identity = 27/61 (44.26%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of CaUC09G170680 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 52.8 bits (125), Expect = 1.3e-07 Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|