CaUC09G170330 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGAGGTTGAAACCGTCCTTAGCCAAGAAGCTTAACCCAAAGGGCCATAGCCCTATTCGCCTAGCAATGAAAAACAATGAAACTGTGATCGTGTTTCGACTTGCCGAGGTCGATCGAGACCTCGTAAGCTTGCACGGGTAAAGGGGTTTAACTCCAATGCATATTGCAGCTTCAAGAGGGACGATGGAAGATAACTTCTTGGCTAAAGTTTTGGATTCATATCCAGAATCTATAATTGAACTTTTCTAAGGAATCTGCTCTTCATATTGCTGTTAAAAAAGACAAAATTGAAGCTTTGAAAATCCTATTGAAGTGGACCAAGCAAGCCAGCATGAAGTCAATACTAAATTGGAGTGACGATAAAGGAAACAACAATCATGCATCTTGCAGCAGCTGA ATGTTGAGGTTGAAACCGTCCTTAGCCAAGAAGCTTAACCCAAAGGGCCATAGCCCTATTCGCCTAGCAATGAAAAACAATGAAACTGTGATCGTGTTTCGACTTGCCGAGGTCGATCGAGACCTCGAATCTGCTCTTCATATTGCTGTTAAAAAAGACAAAATTGAAGCTTTGAAAATCCTATTGAAGTGGACCAAGCAAGCCAGCATGAAGTCAATACTAAATTGGAGTGACGATAAAGGAAACAACAATCATGCATCTTGCAGCAGCTGA ATGTTGAGGTTGAAACCGTCCTTAGCCAAGAAGCTTAACCCAAAGGGCCATAGCCCTATTCGCCTAGCAATGAAAAACAATGAAACTGTGATCGTGTTTCGACTTGCCGAGGTCGATCGAGACCTCGAATCTGCTCTTCATATTGCTGTTAAAAAAGACAAAATTGAAGCTTTGAAAATCCTATTGAAGTGGACCAAGCAAGCCAGCATGAAGTCAATACTAAATTGGAGTGACGATAAAGGAAACAACAATCATGCATCTTGCAGCAGCTGA MLRLKPSLAKKLNPKGHSPIRLAMKNNETVIVFRLAEVDRDLESALHIAVKKDKIEALKILLKWTKQASMKSILNWSDDKGNNNHASCSS Homology
BLAST of CaUC09G170330 vs. NCBI nr
Match: XP_038886825.1 (ankyrin repeat-containing protein BDA1-like isoform X1 [Benincasa hispida] >XP_038886826.1 ankyrin repeat-containing protein BDA1-like isoform X1 [Benincasa hispida] >XP_038886827.1 ankyrin repeat-containing protein BDA1-like isoform X1 [Benincasa hispida] >XP_038886829.1 ankyrin repeat-containing protein BDA1-like isoform X1 [Benincasa hispida]) HSP 1 Score: 115.2 bits (287), Expect = 3.0e-22 Identity = 69/125 (55.20%), Postives = 76/125 (60.80%), Query Frame = 0
BLAST of CaUC09G170330 vs. NCBI nr
Match: XP_038886831.1 (ankyrin repeat-containing protein BDA1-like isoform X3 [Benincasa hispida] >XP_038886832.1 ankyrin repeat-containing protein BDA1-like isoform X3 [Benincasa hispida]) HSP 1 Score: 115.2 bits (287), Expect = 3.0e-22 Identity = 69/125 (55.20%), Postives = 76/125 (60.80%), Query Frame = 0
BLAST of CaUC09G170330 vs. NCBI nr
Match: XP_038886833.1 (ankyrin repeat-containing protein BDA1-like isoform X4 [Benincasa hispida] >XP_038886834.1 ankyrin repeat-containing protein BDA1-like isoform X4 [Benincasa hispida]) HSP 1 Score: 115.2 bits (287), Expect = 3.0e-22 Identity = 69/125 (55.20%), Postives = 76/125 (60.80%), Query Frame = 0
BLAST of CaUC09G170330 vs. NCBI nr
Match: XP_038886830.1 (ankyrin repeat-containing protein BDA1-like isoform X2 [Benincasa hispida]) HSP 1 Score: 115.2 bits (287), Expect = 3.0e-22 Identity = 69/125 (55.20%), Postives = 76/125 (60.80%), Query Frame = 0
BLAST of CaUC09G170330 vs. NCBI nr
Match: XP_022971877.1 (ankyrin repeat-containing protein BDA1-like [Cucurbita maxima]) HSP 1 Score: 97.4 bits (241), Expect = 6.5e-17 Identity = 56/125 (44.80%), Postives = 72/125 (57.60%), Query Frame = 0
BLAST of CaUC09G170330 vs. ExPASy TrEMBL
Match: A0A6J1I835 (ankyrin repeat-containing protein BDA1-like OS=Cucurbita maxima OX=3661 GN=LOC111471792 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 3.1e-17 Identity = 56/125 (44.80%), Postives = 72/125 (57.60%), Query Frame = 0
BLAST of CaUC09G170330 vs. ExPASy TrEMBL
Match: A0A6J1I885 (ankyrin repeat-containing protein BDA1-like OS=Cucurbita maxima OX=3661 GN=LOC111470572 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 3.1e-17 Identity = 56/125 (44.80%), Postives = 72/125 (57.60%), Query Frame = 0
BLAST of CaUC09G170330 vs. ExPASy TrEMBL
Match: A0A6J1IAU0 (ankyrin repeat-containing protein BDA1-like OS=Cucurbita maxima OX=3661 GN=LOC111471791 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 3.1e-17 Identity = 56/125 (44.80%), Postives = 72/125 (57.60%), Query Frame = 0
BLAST of CaUC09G170330 vs. ExPASy TrEMBL
Match: A0A6J1I355 (ankyrin repeat-containing protein BDA1-like OS=Cucurbita maxima OX=3661 GN=LOC111470571 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 3.1e-17 Identity = 56/125 (44.80%), Postives = 72/125 (57.60%), Query Frame = 0
BLAST of CaUC09G170330 vs. ExPASy TrEMBL
Match: A0A6J1I6V2 (ankyrin repeat-containing protein BDA1-like OS=Cucurbita maxima OX=3661 GN=LOC111470533 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 1.6e-16 Identity = 55/125 (44.00%), Postives = 70/125 (56.00%), Query Frame = 0
BLAST of CaUC09G170330 vs. TAIR 10
Match: AT4G10720.1 (Ankyrin repeat family protein ) HSP 1 Score: 48.5 bits (114), Expect = 3.2e-06 Identity = 40/131 (30.53%), Postives = 56/131 (42.75%), Query Frame = 0
BLAST of CaUC09G170330 vs. TAIR 10
Match: AT4G10720.2 (Ankyrin repeat family protein ) HSP 1 Score: 48.5 bits (114), Expect = 3.2e-06 Identity = 40/131 (30.53%), Postives = 56/131 (42.75%), Query Frame = 0
BLAST of CaUC09G170330 vs. TAIR 10
Match: AT4G11000.1 (Ankyrin repeat family protein ) HSP 1 Score: 47.0 bits (110), Expect = 9.4e-06 Identity = 30/82 (36.59%), Postives = 40/82 (48.78%), Query Frame = 0
BLAST of CaUC09G170330 vs. TAIR 10
Match: AT1G14480.1 (Ankyrin repeat family protein ) HSP 1 Score: 43.9 bits (102), Expect = 7.9e-05 Identity = 31/113 (27.43%), Postives = 51/113 (45.13%), Query Frame = 0
BLAST of CaUC09G170330 vs. TAIR 10
Match: AT5G54620.1 (Ankyrin repeat family protein ) HSP 1 Score: 42.7 bits (99), Expect = 1.8e-04 Identity = 35/131 (26.72%), Postives = 52/131 (39.69%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
|