CaUC07G140010 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAAGCTTCCGATCATAAGGCTTTGCCTTTTGGTGGTGACAATGGCTGCGCTCCTAACTGCAGCTCATCTTGCCGAGGCGGTGACTTGCAGCACTATGGAGCTTAGTCCATGCATGGGTGCAATAACGTCGACCGCACCACCGCCGGCCGCTTGTTGCAGTAAGCTGAGGGAGCAACAACCGTGCTTTTGTGGGTACCTCAAGAATCCAAGCTTGGGAGGTTACGTGCAATCTCCTCGTGCCAAAACTGTTATTTCCAAATGTGGTGTTCCCTTCCCCAAATGCTAG ATGAAAAAGCTTCCGATCATAAGGCTTTGCCTTTTGGTGGTGACAATGGCTGCGCTCCTAACTGCAGCTCATCTTGCCGAGGCGGTGACTTGCAGCACTATGGAGCTTAGTCCATGCATGGGTGCAATAACGTCGACCGCACCACCGCCGGCCGCTTGTTGCAGTAAGCTGAGGGAGCAACAACCGTGCTTTTGTGGGTACCTCAAGAATCCAAGCTTGGGAGGTTACGTGCAATCTCCTCGTGCCAAAACTGTTATTTCCAAATGTGGTGTTCCCTTCCCCAAATGCTAG ATGAAAAAGCTTCCGATCATAAGGCTTTGCCTTTTGGTGGTGACAATGGCTGCGCTCCTAACTGCAGCTCATCTTGCCGAGGCGGTGACTTGCAGCACTATGGAGCTTAGTCCATGCATGGGTGCAATAACGTCGACCGCACCACCGCCGGCCGCTTGTTGCAGTAAGCTGAGGGAGCAACAACCGTGCTTTTGTGGGTACCTCAAGAATCCAAGCTTGGGAGGTTACGTGCAATCTCCTCGTGCCAAAACTGTTATTTCCAAATGTGGTGTTCCCTTCCCCAAATGCTAG MKKLPIIRLCLLVVTMAALLTAAHLAEAVTCSTMELSPCMGAITSTAPPPAACCSKLREQQPCFCGYLKNPSLGGYVQSPRAKTVISKCGVPFPKC Homology
BLAST of CaUC07G140010 vs. NCBI nr
Match: XP_038904866.1 (non-specific lipid-transfer protein 2-like [Benincasa hispida]) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-33 Identity = 77/96 (80.21%), Postives = 81/96 (84.38%), Query Frame = 0
BLAST of CaUC07G140010 vs. NCBI nr
Match: XP_008444080.1 (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis melo] >KAA0064174.1 non-specific lipid-transfer protein 2-like [Cucumis melo var. makuwa]) HSP 1 Score: 145.2 bits (365), Expect = 2.9e-31 Identity = 71/96 (73.96%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of CaUC07G140010 vs. NCBI nr
Match: KGN53818.1 (hypothetical protein Csa_014950 [Cucumis sativus]) HSP 1 Score: 142.5 bits (358), Expect = 1.9e-30 Identity = 69/96 (71.88%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of CaUC07G140010 vs. NCBI nr
Match: XP_022143278.1 (non-specific lipid-transfer protein 2-like [Momordica charantia]) HSP 1 Score: 129.4 bits (324), Expect = 1.6e-26 Identity = 66/96 (68.75%), Postives = 75/96 (78.12%), Query Frame = 0
BLAST of CaUC07G140010 vs. NCBI nr
Match: XP_022148226.1 (non-specific lipid-transfer protein 2-like [Momordica charantia]) HSP 1 Score: 121.7 bits (304), Expect = 3.4e-24 Identity = 65/98 (66.33%), Postives = 73/98 (74.49%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 2.8e-21 Identity = 44/68 (64.71%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.0e-19 Identity = 47/94 (50.00%), Postives = 62/94 (65.96%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.5e-18 Identity = 40/67 (59.70%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy Swiss-Prot
Match: A2XBN5 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=LTP-2 PE=3 SV=2) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-12 Identity = 40/96 (41.67%), Postives = 53/96 (55.21%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy Swiss-Prot
Match: Q10ST8 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=LTP-2 PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-12 Identity = 41/96 (42.71%), Postives = 52/96 (54.17%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy TrEMBL
Match: A0A5A7VAB3 (Non-specific lipid-transfer protein 2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold548G001020 PE=4 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 1.4e-31 Identity = 71/96 (73.96%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy TrEMBL
Match: A0A1S3B931 (non-specific lipid-transfer protein 2-like OS=Cucumis melo OX=3656 GN=LOC103487520 PE=4 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 1.4e-31 Identity = 71/96 (73.96%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy TrEMBL
Match: A0A0A0KW85 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G146250 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 9.1e-31 Identity = 69/96 (71.88%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy TrEMBL
Match: A0A0A0L100 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G141240 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 1.6e-30 Identity = 68/96 (70.83%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of CaUC07G140010 vs. ExPASy TrEMBL
Match: A0A6J1CQB8 (non-specific lipid-transfer protein 2-like OS=Momordica charantia OX=3673 GN=LOC111013188 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 8.0e-27 Identity = 66/96 (68.75%), Postives = 75/96 (78.12%), Query Frame = 0
BLAST of CaUC07G140010 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 97.8 bits (242), Expect = 4.9e-21 Identity = 45/91 (49.45%), Postives = 63/91 (69.23%), Query Frame = 0
BLAST of CaUC07G140010 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 97.4 bits (241), Expect = 6.5e-21 Identity = 48/96 (50.00%), Postives = 65/96 (67.71%), Query Frame = 0
BLAST of CaUC07G140010 vs. TAIR 10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 80.5 bits (197), Expect = 8.2e-16 Identity = 33/68 (48.53%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of CaUC07G140010 vs. TAIR 10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-14 Identity = 42/102 (41.18%), Postives = 56/102 (54.90%), Query Frame = 0
BLAST of CaUC07G140010 vs. TAIR 10
Match: AT5G38160.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 73.9 bits (180), Expect = 7.7e-14 Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|