![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CaUC05G099460 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTTGAGTTCCGTTTTCAGAAACAGCATCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGAGCAGCTTCGCGATATTTTCCTCAAGCACGATGGCGACGGCGACGGCCGACTTTCTCGCATGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTGTCTCAAAGCCGCCGATTCCGACGGCGATGGCTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGAATACGCTATAATTTGA ATGGCGTTGAGTTCCGTTTTCAGAAACAGCATCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGAGCAGCTTCGCGATATTTTCCTCAAGCACGATGGCGACGGCGACGGCCGACTTTCTCGCATGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTGTCTCAAAGCCGCCGATTCCGACGGCGATGGCTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGAATACGCTATAATTTGA ATGGCGTTGAGTTCCGTTTTCAGAAACAGCATCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGAGCAGCTTCGCGATATTTTCCTCAAGCACGATGGCGACGGCGACGGCCGACTTTCTCGCATGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTGTCTCAAAGCCGCCGATTCCGACGGCGATGGCTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGAATACGCTATAATTTGA MALSSVFRNSISDYKRCPVPFSREQLRDIFLKHDGDGDGRLSRMELKSAFDSLGSNWSRFRARQCLKAADSDGDGYVTLDELDRLLDYAVRCEYAII Homology
BLAST of CaUC05G099460 vs. NCBI nr
Match: KAG6591371.1 (putative calcium-binding protein CML10, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 186.4 bits (472), Expect = 1.1e-43 Identity = 88/96 (91.67%), Postives = 93/96 (96.88%), Query Frame = 0
BLAST of CaUC05G099460 vs. NCBI nr
Match: KGN55186.1 (hypothetical protein Csa_012423 [Cucumis sativus]) HSP 1 Score: 184.5 bits (467), Expect = 4.4e-43 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 0
BLAST of CaUC05G099460 vs. NCBI nr
Match: KAA0064377.1 (Calcium-binding EF-hand [Cucumis melo var. makuwa] >TYK20210.1 Calcium-binding EF-hand [Cucumis melo var. makuwa]) HSP 1 Score: 177.6 bits (449), Expect = 5.3e-41 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 0
BLAST of CaUC05G099460 vs. NCBI nr
Match: KAG6608480.1 (putative calcium-binding protein CML10, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 169.1 bits (427), Expect = 1.9e-38 Identity = 78/91 (85.71%), Postives = 87/91 (95.60%), Query Frame = 0
BLAST of CaUC05G099460 vs. NCBI nr
Match: KAG7029343.1 (Calcium-binding protein CML37, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 100.9 bits (250), Expect = 6.3e-18 Identity = 45/83 (54.22%), Postives = 61/83 (73.49%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy Swiss-Prot
Match: Q8RZB5 (Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica OX=39947 GN=CML10 PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.6e-08 Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy Swiss-Prot
Match: Q6L4D4 (Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica OX=39947 GN=CML15 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 8.9e-07 Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy Swiss-Prot
Match: Q9LE22 (Probable calcium-binding protein CML27 OS=Arabidopsis thaliana OX=3702 GN=CML27 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.5e-06 Identity = 22/62 (35.48%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy Swiss-Prot
Match: O64943 (Polcalcin Jun o 2 OS=Juniperus oxycedrus OX=69008 PE=1 SV=2) HSP 1 Score: 53.5 bits (127), Expect = 1.5e-06 Identity = 25/60 (41.67%), Postives = 37/60 (61.67%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy Swiss-Prot
Match: A0T2M3 (Polcalcin Cup a 4 OS=Hesperocyparis arizonica OX=49011 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.4e-06 Identity = 24/60 (40.00%), Postives = 36/60 (60.00%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy TrEMBL
Match: A0A0A0L4V0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G639740 PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 2.1e-43 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy TrEMBL
Match: A0A5A7VBH2 (Calcium-binding EF-hand OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G003470 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.6e-41 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy TrEMBL
Match: A0A7N2KRS3 (Uncharacterized protein OS=Quercus lobata OX=97700 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.5e-17 Identity = 45/89 (50.56%), Postives = 61/89 (68.54%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy TrEMBL
Match: A0A2N9FYQ0 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS20260 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 7.6e-17 Identity = 42/86 (48.84%), Postives = 58/86 (67.44%), Query Frame = 0
BLAST of CaUC05G099460 vs. ExPASy TrEMBL
Match: A0A5N6RQV2 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_018544 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 1.3e-16 Identity = 46/89 (51.69%), Postives = 62/89 (69.66%), Query Frame = 0
BLAST of CaUC05G099460 vs. TAIR 10
Match: AT1G18210.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 53.5 bits (127), Expect = 1.1e-07 Identity = 22/62 (35.48%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of CaUC05G099460 vs. TAIR 10
Match: AT1G18210.2 (Calcium-binding EF-hand family protein ) HSP 1 Score: 53.5 bits (127), Expect = 1.1e-07 Identity = 22/62 (35.48%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of CaUC05G099460 vs. TAIR 10
Match: AT3G50770.1 (calmodulin-like 41 ) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-06 Identity = 23/65 (35.38%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of CaUC05G099460 vs. TAIR 10
Match: AT3G03410.1 (EF hand calcium-binding protein family ) HSP 1 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 22/63 (34.92%), Postives = 37/63 (58.73%), Query Frame = 0
BLAST of CaUC05G099460 vs. TAIR 10
Match: AT1G76640.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 46.2 bits (108), Expect = 1.7e-05 Identity = 26/69 (37.68%), Postives = 38/69 (55.07%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|