CaUC02G030870 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGATGGCGCAGTGGTGCGGCGCTGTAGCTAGGGGAGTGATGGCGGCGGAGCGACGGTCTCCTTCTCTAACGTCGTCAATGGTGGTCGAAGGACTGGTGCCAATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAAGGGAAAAGATTCAAAGGCTCGTACGGAAACGCCAGGCCGAAGAAGGAGAAGAAGATACAGCGAATCAAGGATAAAATTGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTTATCTGA ATGGCGATGGCGCAGTGGTGCGGCGCTGTAGCTAGGGGAGTGATGGCGGCGGAGCGACGGTCTCCTTCTCTAACGTCGTCAATGGTGGTCGAAGGACTGGTGCCAATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAAGGGAAAAGATTCAAAGGCTCGTACGGAAACGCCAGGCCGAAGAAGGAGAAGAAGATACAGCGAATCAAGGATAAAATTGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTTATCTGA ATGGCGATGGCGCAGTGGTGCGGCGCTGTAGCTAGGGGAGTGATGGCGGCGGAGCGACGGTCTCCTTCTCTAACGTCGTCAATGGTGGTCGAAGGACTGGTGCCAATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAAGGGAAAAGATTCAAAGGCTCGTACGGAAACGCCAGGCCGAAGAAGGAGAAGAAGATACAGCGAATCAAGGATAAAATTGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTTATCTGA MAMAQWCGAVARGVMAAERRSPSLTSSMVVEGLVPILCGRGDKKTKKGKRFKGSYGNARPKKEKKIQRIKDKIEVPSSTPWPLPFKLI Homology
BLAST of CaUC02G030870 vs. NCBI nr
Match: XP_022933003.1 (30S ribosomal protein S31, mitochondrial [Cucurbita moschata] >XP_023529502.1 30S ribosomal protein S31, mitochondrial isoform X1 [Cucurbita pepo subsp. pepo] >XP_023529503.1 30S ribosomal protein S31, mitochondrial isoform X2 [Cucurbita pepo subsp. pepo] >KAG6588415.1 30S ribosomal protein S31, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia] >KAG7022258.1 30S ribosomal protein S31, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 169.5 bits (428), Expect = 1.3e-38 Identity = 85/88 (96.59%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of CaUC02G030870 vs. NCBI nr
Match: XP_008448047.1 (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis melo] >KAA0033759.1 30S ribosomal protein S31 [Cucumis melo var. makuwa] >TYK22378.1 30S ribosomal protein S31 [Cucumis melo var. makuwa]) HSP 1 Score: 168.7 bits (426), Expect = 2.2e-38 Identity = 83/88 (94.32%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of CaUC02G030870 vs. NCBI nr
Match: XP_011658557.1 (30S ribosomal protein S31, mitochondrial [Cucumis sativus]) HSP 1 Score: 167.9 bits (424), Expect = 3.8e-38 Identity = 84/88 (95.45%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of CaUC02G030870 vs. NCBI nr
Match: XP_038888313.1 (30S ribosomal protein S31, mitochondrial [Benincasa hispida]) HSP 1 Score: 166.8 bits (421), Expect = 8.5e-38 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of CaUC02G030870 vs. NCBI nr
Match: XP_022952601.1 (30S ribosomal protein S31, mitochondrial-like [Cucurbita moschata]) HSP 1 Score: 162.9 bits (411), Expect = 1.2e-36 Identity = 81/86 (94.19%), Postives = 83/86 (96.51%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy Swiss-Prot
Match: Q9SJU8 (30S ribosomal protein S31, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g21290 PE=1 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.6e-25 Identity = 59/98 (60.20%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy Swiss-Prot
Match: P47909 (30S ribosomal protein S31, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0528100 PE=3 SV=2) HSP 1 Score: 100.9 bits (250), Expect = 7.5e-21 Identity = 45/53 (84.91%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy Swiss-Prot
Match: P47910 (30S ribosomal protein S31, chloroplastic OS=Spinacia oleracea OX=3562 GN=RPS31 PE=1 SV=2) HSP 1 Score: 50.8 bits (120), Expect = 8.9e-06 Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy Swiss-Prot
Match: O80439 (30S ribosomal protein S31, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS31 PE=1 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 9.9e-05 Identity = 23/45 (51.11%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy TrEMBL
Match: A0A6J1F3E9 (30S ribosomal protein S31, mitochondrial OS=Cucurbita moschata OX=3662 GN=LOC111439636 PE=3 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 6.4e-39 Identity = 85/88 (96.59%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy TrEMBL
Match: A0A5A7SX60 (30S ribosomal protein S31 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1428G001030 PE=3 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.1e-38 Identity = 83/88 (94.32%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy TrEMBL
Match: A0A1S3BI88 (30S ribosomal protein S31, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103490344 PE=3 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.1e-38 Identity = 83/88 (94.32%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy TrEMBL
Match: A0A0A0K141 (30S ribosomal protein S31, mitochondrial OS=Cucumis sativus OX=3659 GN=Csa_7G006280 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.9e-38 Identity = 84/88 (95.45%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of CaUC02G030870 vs. ExPASy TrEMBL
Match: A0A6J1GKP4 (30S ribosomal protein S31, mitochondrial-like OS=Cucurbita moschata OX=3662 GN=LOC111455241 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 6.0e-37 Identity = 81/86 (94.19%), Postives = 83/86 (96.51%), Query Frame = 0
BLAST of CaUC02G030870 vs. TAIR 10
Match: AT2G21290.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 63 Blast hits to 63 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 63; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 114.0 bits (284), Expect = 6.1e-26 Identity = 59/98 (60.20%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of CaUC02G030870 vs. TAIR 10
Match: AT2G38140.1 (plastid-specific ribosomal protein 4 ) HSP 1 Score: 47.4 bits (111), Expect = 7.0e-06 Identity = 23/45 (51.11%), Postives = 32/45 (71.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|