
CaUC01G024830 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAACTACAAACCCCCAAAAGGAAGAGAAGAGCCTACAAGAAGCTTAACAGTGCATACTCGATCCGCATTTGCTCCCTCTCTTCTCTTCTGCATCTTCCTCAGTACATCCAACTCCGGCGGTGCAACTTTGATACAATGGCGCCAAAGAAGGATAAGGCTCCTCCCCCATCTTCCAAGCCTGCTAAATCTGGTGGAGGAAAGCAGAAGAAGAAGAAGTGGAGCAAAGGAAAGCAAAAGGAGAAGGTCAACAACATGGTTTTGTTTGATCAAGGAACTTATGACAAGCTTCTCGTTGAAGTTCCCAAGTACAAGCTTGTCACTCCATCAATCTTGTCCGATAGGTTGAGGATCAATGGATCTCTTGCACGAAAAGAGCAATCAAGGATTTGA ATGCAACTACAAACCCCCAAAAGGAAGAGAAGAGCCTACAAGAAGCTTAACAGTGCATACTCGATCCGCATTTGCTCCCTCTCTTCTCTTCTGCATCTTCCTCAGTACATCCAACTCCGGCGGTGCAACTTTGATACAATGGCGCCAAAGAAGGATAAGGCTCCTCCCCCATCTTCCAAGCCTGCTAAATCTGGTGGAGGAAAGCAGAAGAAGAAGAAGTGGAGCAAAGGAAAGCAAAAGGAGAAGGTCAACAACATGGTTTTGTTTGATCAAGGAACTTATGACAAGCTTCTCGTTGAAGTTCCCAAGTACAAGCTTGTCACTCCATCAATCTTGTCCGATAGGTTGAGGATCAATGGATCTCTTGCACGAAAAGAGCAATCAAGGATTTGA ATGCAACTACAAACCCCCAAAAGGAAGAGAAGAGCCTACAAGAAGCTTAACAGTGCATACTCGATCCGCATTTGCTCCCTCTCTTCTCTTCTGCATCTTCCTCAGTACATCCAACTCCGGCGGTGCAACTTTGATACAATGGCGCCAAAGAAGGATAAGGCTCCTCCCCCATCTTCCAAGCCTGCTAAATCTGGTGGAGGAAAGCAGAAGAAGAAGAAGTGGAGCAAAGGAAAGCAAAAGGAGAAGGTCAACAACATGGTTTTGTTTGATCAAGGAACTTATGACAAGCTTCTCGTTGAAGTTCCCAAGTACAAGCTTGTCACTCCATCAATCTTGTCCGATAGGTTGAGGATCAATGGATCTCTTGCACGAAAAGAGCAATCAAGGATTTGA MQLQTPKRKRRAYKKLNSAYSIRICSLSSLLHLPQYIQLRRCNFDTMAPKKDKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQGTYDKLLVEVPKYKLVTPSILSDRLRINGSLARKEQSRI Homology
BLAST of CaUC01G024830 vs. NCBI nr
Match: KAG6573888.1 (40S ribosomal protein S25-2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 166.4 bits (420), Expect = 1.6e-37 Identity = 87/99 (87.88%), Postives = 91/99 (91.92%), Query Frame = 0
BLAST of CaUC01G024830 vs. NCBI nr
Match: CBI32218.3 (unnamed protein product, partial [Vitis vinifera]) HSP 1 Score: 154.5 bits (389), Expect = 6.5e-34 Identity = 79/94 (84.04%), Postives = 87/94 (92.55%), Query Frame = 0
BLAST of CaUC01G024830 vs. NCBI nr
Match: XP_022961406.1 (40S ribosomal protein S25-2-like [Cucurbita moschata] >XP_022968822.1 40S ribosomal protein S25-2-like [Cucurbita maxima] >XP_023545343.1 40S ribosomal protein S25-2-like [Cucurbita pepo subsp. pepo] >KAG6590412.1 40S ribosomal protein S25-2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7023962.1 40S ribosomal protein S25-2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 151.4 bits (381), Expect = 5.5e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. NCBI nr
Match: XP_022945101.1 (40S ribosomal protein S25-2-like [Cucurbita moschata] >XP_022968354.1 40S ribosomal protein S25-2 [Cucurbita maxima] >XP_023541368.1 40S ribosomal protein S25-2-like [Cucurbita pepo subsp. pepo] >KAG7012952.1 40S ribosomal protein S25-2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 151.4 bits (381), Expect = 5.5e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. NCBI nr
Match: XP_016900931.1 (PREDICTED: 40S ribosomal protein S25-2-like [Cucumis melo] >XP_038878537.1 40S ribosomal protein S25-2 [Benincasa hispida] >TYK10188.1 40S ribosomal protein S25-2-like [Cucumis melo var. makuwa]) HSP 1 Score: 151.4 bits (381), Expect = 5.5e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy Swiss-Prot
Match: Q9SIK2 (40S ribosomal protein S25-2 OS=Arabidopsis thaliana OX=3702 GN=RPS25B PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.1e-33 Identity = 72/79 (91.14%), Postives = 76/79 (96.20%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy Swiss-Prot
Match: Q9SIW5 (40S ribosomal protein S25-1 OS=Arabidopsis thaliana OX=3702 GN=RPS25A PE=3 SV=3) HSP 1 Score: 142.1 bits (357), Expect = 4.4e-33 Identity = 72/79 (91.14%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy Swiss-Prot
Match: Q8GYL5 (40S ribosomal protein S25-3 OS=Arabidopsis thaliana OX=3702 GN=RPS25D PE=3 SV=2) HSP 1 Score: 141.7 bits (356), Expect = 5.7e-33 Identity = 72/79 (91.14%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy Swiss-Prot
Match: Q9T029 (40S ribosomal protein S25-4 OS=Arabidopsis thaliana OX=3702 GN=RPS25E PE=3 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 5.7e-33 Identity = 71/79 (89.87%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy Swiss-Prot
Match: P46301 (40S ribosomal protein S25 OS=Solanum lycopersicum OX=4081 GN=RPS25 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.1e-31 Identity = 70/79 (88.61%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy TrEMBL
Match: A0A6J1HUK6 (40S ribosomal protein S25 OS=Cucurbita maxima OX=3661 GN=LOC111467942 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 2.7e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy TrEMBL
Match: A0A6J1HZE7 (40S ribosomal protein S25 OS=Cucurbita maxima OX=3661 GN=LOC111467614 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 2.7e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy TrEMBL
Match: A0A5D3CG38 (40S ribosomal protein S25 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G003330 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 2.7e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy TrEMBL
Match: A0A6J1HAA0 (40S ribosomal protein S25 OS=Cucurbita moschata OX=3662 GN=LOC111461987 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 2.7e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. ExPASy TrEMBL
Match: A0A6J1FZX1 (40S ribosomal protein S25 OS=Cucurbita moschata OX=3662 GN=LOC111449439 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 2.7e-33 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 0
BLAST of CaUC01G024830 vs. TAIR 10
Match: AT2G21580.1 (Ribosomal protein S25 family protein ) HSP 1 Score: 144.1 bits (362), Expect = 8.2e-35 Identity = 72/79 (91.14%), Postives = 76/79 (96.20%), Query Frame = 0
BLAST of CaUC01G024830 vs. TAIR 10
Match: AT4G39200.1 (Ribosomal protein S25 family protein ) HSP 1 Score: 141.7 bits (356), Expect = 4.0e-34 Identity = 71/79 (89.87%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CaUC01G024830 vs. TAIR 10
Match: AT4G34555.1 (Ribosomal protein S25 family protein ) HSP 1 Score: 141.7 bits (356), Expect = 4.0e-34 Identity = 72/79 (91.14%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CaUC01G024830 vs. TAIR 10
Match: AT2G21580.2 (Ribosomal protein S25 family protein ) HSP 1 Score: 138.3 bits (347), Expect = 4.5e-33 Identity = 71/79 (89.87%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CaUC01G024830 vs. TAIR 10
Match: AT4G39200.2 (Ribosomal protein S25 family protein ) HSP 1 Score: 136.0 bits (341), Expect = 2.2e-32 Identity = 70/79 (88.61%), Postives = 74/79 (93.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|