CaUC01G010690 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGTTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTTGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGTTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTTGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGTTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTTGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA MLLITVTSSQLDLVGGYEPIKNIDDPHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVAGTNYNLQLTALEGIVSKTYGTLVFTDLKNENHLINFYDLSN Homology
BLAST of CaUC01G010690 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 169.1 bits (427), Expect = 2.0e-38 Identity = 82/99 (82.83%), Postives = 90/99 (90.91%), Query Frame = 0
BLAST of CaUC01G010690 vs. NCBI nr
Match: TYK30896.1 (cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 161.4 bits (407), Expect = 4.2e-36 Identity = 79/102 (77.45%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of CaUC01G010690 vs. NCBI nr
Match: KAA0035647.1 (cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 161.4 bits (407), Expect = 4.2e-36 Identity = 79/102 (77.45%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of CaUC01G010690 vs. NCBI nr
Match: XP_038895826.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 160.2 bits (404), Expect = 9.3e-36 Identity = 77/94 (81.91%), Postives = 86/94 (91.49%), Query Frame = 0
BLAST of CaUC01G010690 vs. NCBI nr
Match: KAG6583729.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 156.8 bits (395), Expect = 1.0e-34 Identity = 76/98 (77.55%), Postives = 87/98 (88.78%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 9.4e-15 Identity = 39/86 (45.35%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-12 Identity = 41/100 (41.00%), Postives = 62/100 (62.00%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 72.8 bits (177), Expect = 2.5e-12 Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.7e-12 Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 1.1e-10 Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy TrEMBL
Match: A0A5D3E5H4 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001040 PE=4 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 2.0e-36 Identity = 79/102 (77.45%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy TrEMBL
Match: A0A5A7T201 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold285G003390 PE=4 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 2.0e-36 Identity = 79/102 (77.45%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 5.0e-35 Identity = 76/98 (77.55%), Postives = 86/98 (87.76%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 6.5e-35 Identity = 75/99 (75.76%), Postives = 89/99 (89.90%), Query Frame = 0
BLAST of CaUC01G010690 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 1.1e-34 Identity = 75/99 (75.76%), Postives = 89/99 (89.90%), Query Frame = 0
BLAST of CaUC01G010690 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 6.7e-16 Identity = 39/86 (45.35%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of CaUC01G010690 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 66.2 bits (160), Expect = 1.7e-11 Identity = 26/61 (42.62%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of CaUC01G010690 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 57.4 bits (137), Expect = 7.9e-09 Identity = 29/74 (39.19%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of CaUC01G010690 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 55.5 bits (132), Expect = 3.0e-08 Identity = 31/90 (34.44%), Postives = 50/90 (55.56%), Query Frame = 0
BLAST of CaUC01G010690 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 54.3 bits (129), Expect = 6.7e-08 Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|