CaUC01G010670 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGGTCTCTCTTTTTCGTTGTTTCTCTTCTCCTCTTTGTGTTGATGTTGTCGGTCACAGCGACAAGTTTACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGACCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGGCTAGGTCTCTCTTTTTCGTTGTTTCTCTTCTCCTCTTTGTGTTGATGTTGTCGGTCACAGCGACAAGTTTACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGACCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGGCTAGGTCTCTCTTTTTCGTTGTTTCTCTTCTCCTCTTTGTGTTGATGTTGTCGGTCACAGCGACAAGTTTACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGACCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA MARSLFFVVSLLLFVLMLSVTATSLRLELVGGYEPIKNIEDQHIQSLGEFAVNEHNKQAKTQLKFETVISGKLQIVAGTNYDLQLTALEGNVSRIYGTLIFTDLKNENHLINFYDLSN Homology
BLAST of CaUC01G010670 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 180.6 bits (457), Expect = 7.7e-42 Identity = 97/119 (81.51%), Postives = 108/119 (90.76%), Query Frame = 0
BLAST of CaUC01G010670 vs. NCBI nr
Match: XP_038895826.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 167.5 bits (423), Expect = 6.7e-38 Identity = 90/114 (78.95%), Postives = 102/114 (89.47%), Query Frame = 0
BLAST of CaUC01G010670 vs. NCBI nr
Match: XP_004151251.1 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 162.2 bits (409), Expect = 2.8e-36 Identity = 86/119 (72.27%), Postives = 102/119 (85.71%), Query Frame = 0
BLAST of CaUC01G010670 vs. NCBI nr
Match: KAE8652869.1 (hypothetical protein Csa_013019 [Cucumis sativus]) HSP 1 Score: 162.2 bits (409), Expect = 2.8e-36 Identity = 86/119 (72.27%), Postives = 102/119 (85.71%), Query Frame = 0
BLAST of CaUC01G010670 vs. NCBI nr
Match: KAG6583732.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 160.2 bits (404), Expect = 1.1e-35 Identity = 85/118 (72.03%), Postives = 101/118 (85.59%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 75.9 bits (185), Expect = 3.5e-13 Identity = 42/102 (41.18%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-11 Identity = 37/92 (40.22%), Postives = 58/92 (63.04%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.9e-11 Identity = 37/95 (38.95%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 4.7e-10 Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.0e-10 Identity = 38/100 (38.00%), Postives = 59/100 (59.00%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy TrEMBL
Match: A0A0A0LYM0 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 1.4e-36 Identity = 86/119 (72.27%), Postives = 102/119 (85.71%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 2.6e-35 Identity = 84/118 (71.19%), Postives = 99/118 (83.90%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 9.8e-35 Identity = 82/119 (68.91%), Postives = 101/119 (84.87%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy TrEMBL
Match: A0A5D3E5H4 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001040 PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 9.8e-35 Identity = 81/112 (72.32%), Postives = 97/112 (86.61%), Query Frame = 0
BLAST of CaUC01G010670 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 1.7e-34 Identity = 82/119 (68.91%), Postives = 101/119 (84.87%), Query Frame = 0
BLAST of CaUC01G010670 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 75.9 bits (185), Expect = 2.5e-14 Identity = 42/102 (41.18%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of CaUC01G010670 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 62.8 bits (151), Expect = 2.2e-10 Identity = 25/61 (40.98%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of CaUC01G010670 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 53.9 bits (128), Expect = 1.0e-07 Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 0
BLAST of CaUC01G010670 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-07 Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 0
BLAST of CaUC01G010670 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 52.0 bits (123), Expect = 3.8e-07 Identity = 28/71 (39.44%), Postives = 40/71 (56.34%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|