CaUC01G009820 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGACATGTGCCTTTTTGTGCTCGTGATGAGTGTGCTTGTCAATCAAACTCAACTTGTGGAGGCAGTGAAATGCAAGGCAAAAGAACTGAGGCCATGTCTTTTCGCATACACAATGTCGGTGGAGCCATCGTCAGCTTGTTGCAACAAGGTGAAGGAGCACAAACAATGCTATTGTGGGTACAAGAAAAATCCAAAGATTCAACCCTATTTACAAGAGGATGCGACCAAAAAAATTATTTCTCAATGTGGGGTTACCACCCCGAAATGCTAG ATGAAAGACATGTGCCTTTTTGTGCTCGTGATGAGTGTGCTTGTCAATCAAACTCAACTTGTGGAGGCAGTGAAATGCAAGGCAAAAGAACTGAGGCCATGTCTTTTCGCATACACAATGTCGGTGGAGCCATCGTCAGCTTGTTGCAACAAGGTGAAGGAGCACAAACAATGCTATTGTGGGTACAAGAAAAATCCAAAGATTCAACCCTATTTACAAGAGGATGCGACCAAAAAAATTATTTCTCAATGTGGGGTTACCACCCCGAAATGCTAG ATGAAAGACATGTGCCTTTTTGTGCTCGTGATGAGTGTGCTTGTCAATCAAACTCAACTTGTGGAGGCAGTGAAATGCAAGGCAAAAGAACTGAGGCCATGTCTTTTCGCATACACAATGTCGGTGGAGCCATCGTCAGCTTGTTGCAACAAGGTGAAGGAGCACAAACAATGCTATTGTGGGTACAAGAAAAATCCAAAGATTCAACCCTATTTACAAGAGGATGCGACCAAAAAAATTATTTCTCAATGTGGGGTTACCACCCCGAAATGCTAG MKDMCLFVLVMSVLVNQTQLVEAVKCKAKELRPCLFAYTMSVEPSSACCNKVKEHKQCYCGYKKNPKIQPYLQEDATKKIISQCGVTTPKC Homology
BLAST of CaUC01G009820 vs. NCBI nr
Match: KGN66906.1 (hypothetical protein Csa_006987 [Cucumis sativus]) HSP 1 Score: 113.6 bits (283), Expect = 8.9e-22 Identity = 49/84 (58.33%), Postives = 65/84 (77.38%), Query Frame = 0
BLAST of CaUC01G009820 vs. NCBI nr
Match: KAE8648143.1 (hypothetical protein Csa_023893, partial [Cucumis sativus]) HSP 1 Score: 104.4 bits (259), Expect = 5.4e-19 Identity = 43/83 (51.81%), Postives = 58/83 (69.88%), Query Frame = 0
BLAST of CaUC01G009820 vs. NCBI nr
Match: KAE8648147.1 (hypothetical protein Csa_023900, partial [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 7.8e-18 Identity = 42/73 (57.53%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of CaUC01G009820 vs. NCBI nr
Match: GAU46076.1 (hypothetical protein TSUD_180120 [Trifolium subterraneum]) HSP 1 Score: 95.9 bits (237), Expect = 1.9e-16 Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of CaUC01G009820 vs. NCBI nr
Match: XP_038904866.1 (non-specific lipid-transfer protein 2-like [Benincasa hispida]) HSP 1 Score: 94.7 bits (234), Expect = 4.3e-16 Identity = 41/86 (47.67%), Postives = 58/86 (67.44%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-14 Identity = 37/91 (40.66%), Postives = 52/91 (57.14%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.3e-12 Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.7e-10 Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy TrEMBL
Match: A0A0A0M3W7 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G711160 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 4.3e-22 Identity = 49/84 (58.33%), Postives = 65/84 (77.38%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy TrEMBL
Match: A0A2Z6NR57 (AAI domain-containing protein OS=Trifolium subterraneum OX=3900 GN=TSUD_180120 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 9.3e-17 Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy TrEMBL
Match: A0A6P4QB35 (non-specific lipid-transfer protein 2 OS=Gossypium arboreum OX=29729 GN=LOC108482197 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 2.3e-15 Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy TrEMBL
Match: A0A2P5YU65 (AAI domain-containing protein OS=Gossypium barbadense OX=3634 GN=ES319_A12G056300v1 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 2.3e-15 Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 0
BLAST of CaUC01G009820 vs. ExPASy TrEMBL
Match: A0A5D2MWB8 (AAI domain-containing protein OS=Gossypium tomentosum OX=34277 GN=ES332_A12G059800v1 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 2.3e-15 Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 0
BLAST of CaUC01G009820 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 69.7 bits (169), Expect = 1.4e-12 Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 0
BLAST of CaUC01G009820 vs. TAIR 10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 69.3 bits (168), Expect = 1.8e-12 Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of CaUC01G009820 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 3.0e-12 Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 0
BLAST of CaUC01G009820 vs. TAIR 10
Match: AT2G14846.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 9.8e-11 Identity = 27/70 (38.57%), Postives = 36/70 (51.43%), Query Frame = 0
BLAST of CaUC01G009820 vs. TAIR 10
Match: AT1G07747.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 62.4 bits (150), Expect = 2.2e-10 Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|