CaUC01G003470 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATATCCAAGGTGTAAGGAGGCGCATCACCGTTCATTTTAGAAAGATGTTTGATTTGATTGATGAGATGATTGATGAACGGCTTAAGATGCAGGAATCGCCTGATTTTACACCGAAAAATGATATGCTACATCATCTTCTTAACATGAGAGAGGAAAACAACGAGATCCCTCTTCATAGAAACCAAATCAAACATTAA ATGGATATCCAAGGTGTAAGGAGGCGCATCACCGTTCATTTTAGAAAGATGTTTGATTTGATTGATGAGATGATTGATGAACGGCTTAAGATGCAGGAATCGCCTGATTTTACACCGAAAAATGATATGCTACATCATCTTCTTAACATGAGAGAGGAAAACAACGAGATCCCTCTTCATAGAAACCAAATCAAACATTAA ATGGATATCCAAGGTGTAAGGAGGCGCATCACCGTTCATTTTAGAAAGATGTTTGATTTGATTGATGAGATGATTGATGAACGGCTTAAGATGCAGGAATCGCCTGATTTTACACCGAAAAATGATATGCTACATCATCTTCTTAACATGAGAGAGGAAAACAACGAGATCCCTCTTCATAGAAACCAAATCAAACATTAA MDIQGVRRRITVHFRKMFDLIDEMIDERLKMQESPDFTPKNDMLHHLLNMREENNEIPLHRNQIKH Homology
BLAST of CaUC01G003470 vs. NCBI nr
Match: KAG6606159.1 (Geraniol 8-hydroxylase, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 116.7 bits (291), Expect = 7.6e-23 Identity = 55/66 (83.33%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of CaUC01G003470 vs. NCBI nr
Match: XP_022958073.1 (geraniol 8-hydroxylase-like [Cucurbita moschata]) HSP 1 Score: 116.7 bits (291), Expect = 7.6e-23 Identity = 55/66 (83.33%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of CaUC01G003470 vs. NCBI nr
Match: XP_004147602.1 (geraniol 8-hydroxylase [Cucumis sativus] >KGN50173.1 hypothetical protein Csa_000164 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 2.9e-22 Identity = 54/66 (81.82%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of CaUC01G003470 vs. NCBI nr
Match: XP_023532730.1 (geraniol 8-hydroxylase-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.4 bits (285), Expect = 3.8e-22 Identity = 54/66 (81.82%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of CaUC01G003470 vs. NCBI nr
Match: XP_023522005.1 (geraniol 8-hydroxylase-like, partial [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.4 bits (285), Expect = 3.8e-22 Identity = 54/66 (81.82%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy Swiss-Prot
Match: W8JMV1 (Cytochrome P450 76T24 OS=Catharanthus roseus OX=4058 GN=CYP76T24 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.1e-07 Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy Swiss-Prot
Match: A0A125QZE2 (11-hydroxysugiol 20-monooxygenase OS=Salvia miltiorrhiza OX=226208 GN=CYP76AK1 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 2.0e-05 Identity = 25/66 (37.88%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy Swiss-Prot
Match: A0A1D8QMD1 (Carnosic acid synthase OS=Salvia fruticosa OX=268906 GN=CYP76AK6 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 4.4e-05 Identity = 24/65 (36.92%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy Swiss-Prot
Match: A0A2K9RG08 (Labd-13Z-ene-9,15,16-triol synthase, chloroplastic OS=Vitex agnus-castus OX=54477 GN=CYP76BK1 PE=1 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.3e-04 Identity = 28/67 (41.79%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy Swiss-Prot
Match: A0A1D8QMG4 (Carnosic acid synthase OS=Rosmarinus officinalis OX=39367 GN=CYP76AK8 PE=1 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 1.7e-04 Identity = 24/66 (36.36%), Postives = 39/66 (59.09%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy TrEMBL
Match: A0A6J1H240 (geraniol 8-hydroxylase-like OS=Cucurbita moschata OX=3662 GN=LOC111459410 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.7e-23 Identity = 55/66 (83.33%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy TrEMBL
Match: A0A0A0KKP6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G157320 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.4e-22 Identity = 54/66 (81.82%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy TrEMBL
Match: A0A5A7THK3 (Geraniol 8-hydroxylase-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold44G003310 PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 2.4e-22 Identity = 55/66 (83.33%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy TrEMBL
Match: A0A1S3ATZ2 (geraniol 8-hydroxylase-like OS=Cucumis melo OX=3656 GN=LOC103482681 PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 2.4e-22 Identity = 55/66 (83.33%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of CaUC01G003470 vs. ExPASy TrEMBL
Match: A0A5A7TJ65 (Geraniol 8-hydroxylase-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold44G003350 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 5.9e-21 Identity = 53/66 (80.30%), Postives = 60/66 (90.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|