
CSPI06G33910 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGTGAAAAGGCTAGCTCAAAGTTCGCAACAGGTTCACTTCGAATTTAAGAATGAAGTTTTACTGGTTGCTAAGTTGCAGCACCGGAATCTGGTTCGGCTTCTTGGCTTTTGCTTTGAGAAGAACGAAAGGCTCCTCATCTATGAGTTTTTGAGAAGAACGAAGATTATCGATTCAAAGTTATCCATCATGATCGTAAAGCTAGTAATATCTTAT ATGGCTGTGAAAAGGCTAGCTCAAAGTTCGCAACAGGTTCACTTCGAATTTAAGAATGAAGTTTTACTGGTTGCTAAGTTGCAGCACCGGAATCTGGTTCGGCTTCTTGGCTTTTGCTTTGAGAAGAACGAAAGGCTCCTCATCTATGAGTTTTTGAGAAGAACGAAGATTATCGATTCAAAGTTATCCATCATGATCGTAAAGCTAGTAATATCTTAT ATGGCTGTGAAAAGGCTAGCTCAAAGTTCGCAACAGGTTCACTTCGAATTTAAGAATGAAGTTTTACTGGTTGCTAAGTTGCAGCACCGGAATCTGGTTCGGCTTCTTGGCTTTTGCTTTGAGAAGAACGAAAGGCTCCTCATCTATGAGTTTTTGAGAAGAACGAAGATTATCGATTCAAAGTTATCCATCATGATCGTAAAGCTAGTAATATCTTAT MAVKRLAQSSQQVHFEFKNEVLLVAKLQHRNLVRLLGFCFEKNERLLIYEFLRRTKIIDSKLSIMIVKLVISY Homology
BLAST of CSPI06G33910 vs. ExPASy Swiss-Prot
Match: O65405 (Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana OX=3702 GN=CRK28 PE=3 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 6.3e-13 Identity = 36/57 (63.16%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy Swiss-Prot
Match: O23082 (Putative receptor-like protein kinase At4g00960 OS=Arabidopsis thaliana OX=3702 GN=At4g00960 PE=3 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 6.3e-13 Identity = 39/57 (68.42%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy Swiss-Prot
Match: Q8GYA4 (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana OX=3702 GN=CRK10 PE=1 SV=3) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-12 Identity = 36/52 (69.23%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy Swiss-Prot
Match: Q9T0J1 (Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CRK26 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-12 Identity = 37/57 (64.91%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy Swiss-Prot
Match: Q8S9L6 (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana OX=3702 GN=CRK29 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-12 Identity = 35/57 (61.40%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy TrEMBL
Match: A0A6J1CLX3 (cysteine-rich receptor-like protein kinase 29 OS=Momordica charantia OX=3673 GN=LOC111012489 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 2.6e-14 Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy TrEMBL
Match: A0A5D3CNE7 (Cysteine-rich receptor-like protein kinase 29 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G006810 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.5e-14 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy TrEMBL
Match: A0A5A7UGV1 (Cysteine-rich receptor-like protein kinase 29 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold120G003650 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.5e-14 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy TrEMBL
Match: A0A0A0KHX8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G516610 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.5e-14 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of CSPI06G33910 vs. ExPASy TrEMBL
Match: A0A1S4DT80 (cysteine-rich receptor-like protein kinase 29 OS=Cucumis melo OX=3656 GN=LOC103485317 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.5e-14 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of CSPI06G33910 vs. NCBI nr
Match: XP_038883071.1 (cysteine-rich receptor-like protein kinase 29 [Benincasa hispida]) HSP 1 Score: 87.8 bits (216), Expect = 4.2e-14 Identity = 44/57 (77.19%), Postives = 49/57 (85.96%), Query Frame = 0
BLAST of CSPI06G33910 vs. NCBI nr
Match: XP_038883236.1 (putative receptor-like protein kinase At4g00960 [Benincasa hispida]) HSP 1 Score: 87.8 bits (216), Expect = 4.2e-14 Identity = 45/57 (78.95%), Postives = 49/57 (85.96%), Query Frame = 0
BLAST of CSPI06G33910 vs. NCBI nr
Match: XP_022142346.1 (cysteine-rich receptor-like protein kinase 29 [Momordica charantia]) HSP 1 Score: 87.4 bits (215), Expect = 5.5e-14 Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 0
BLAST of CSPI06G33910 vs. NCBI nr
Match: TYK13075.1 (cysteine-rich receptor-like protein kinase 29 [Cucumis melo var. makuwa]) HSP 1 Score: 86.7 bits (213), Expect = 9.3e-14 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of CSPI06G33910 vs. NCBI nr
Match: KAA0052749.1 (cysteine-rich receptor-like protein kinase 29 [Cucumis melo var. makuwa]) HSP 1 Score: 86.7 bits (213), Expect = 9.3e-14 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of CSPI06G33910 vs. TAIR 10
Match: AT4G21400.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 28 ) HSP 1 Score: 74.3 bits (181), Expect = 4.5e-14 Identity = 36/57 (63.16%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of CSPI06G33910 vs. TAIR 10
Match: AT4G00960.1 (Protein kinase superfamily protein ) HSP 1 Score: 74.3 bits (181), Expect = 4.5e-14 Identity = 39/57 (68.42%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of CSPI06G33910 vs. TAIR 10
Match: AT4G23180.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 10 ) HSP 1 Score: 73.6 bits (179), Expect = 7.6e-14 Identity = 36/52 (69.23%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of CSPI06G33910 vs. TAIR 10
Match: AT3G45860.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 4 ) HSP 1 Score: 73.2 bits (178), Expect = 9.9e-14 Identity = 35/52 (67.31%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of CSPI06G33910 vs. TAIR 10
Match: AT4G21410.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 29 ) HSP 1 Score: 73.2 bits (178), Expect = 9.9e-14 Identity = 35/57 (61.40%), Postives = 46/57 (80.70%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|