
CSPI06G26330 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCTGATCCAGCGCCTGGTGCCGGCGGCTATACTCCAGTTAAGGATCCTCAAAGCTTACGAATGCAAGAATTAGCTGAATGGGCAGTAGAAGAGTACAACAAAAAAGAAGGGACACACTTGAGGTTTGTTTGTATATTGGTGTGTGAGTCGCAGATTGTGGAAGGAGTCAACTACCGCTTTATCTTGAGGGCTAAGGATGAAAACGATAATGAAGGAAACTATGAGGCTATTGTCTGGGAGAAAACATGGGAGCATTTCAAGGGGCTGGTTTACTTTAAGCAACTCTTATTGACTGAATCATGA ATGGCTTCTGATCCAGCGCCTGGTGCCGGCGGCTATACTCCAGTTAAGGATCCTCAAAGCTTACGAATGCAAGAATTAGCTGAATGGGCAGTAGAAGAGTACAACAAAAAAGAAGGGACACACTTGAGGTTTGTTTGTATATTGGTGTGTGAGTCGCAGATTGTGGAAGGAGTCAACTACCGCTTTATCTTGAGGGCTAAGGATGAAAACGATAATGAAGGAAACTATGAGGCTATTGTCTGGGAGAAAACATGGGAGCATTTCAAGGGGCTGGTTTACTTTAAGCAACTCTTATTGACTGAATCATGA ATGGCTTCTGATCCAGCGCCTGGTGCCGGCGGCTATACTCCAGTTAAGGATCCTCAAAGCTTACGAATGCAAGAATTAGCTGAATGGGCAGTAGAAGAGTACAACAAAAAAGAAGGGACACACTTGAGGTTTGTTTGTATATTGGTGTGTGAGTCGCAGATTGTGGAAGGAGTCAACTACCGCTTTATCTTGAGGGCTAAGGATGAAAACGATAATGAAGGAAACTATGAGGCTATTGTCTGGGAGAAAACATGGGAGCATTTCAAGGGGCTGGTTTACTTTAAGCAACTCTTATTGACTGAATCATGA MASDPAPGAGGYTPVKDPQSLRMQELAEWAVEEYNKKEGTHLRFVCILVCESQIVEGVNYRFILRAKDENDNEGNYEAIVWEKTWEHFKGLVYFKQLLLTES* Homology
BLAST of CSPI06G26330 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 81.3 bits (199), Expect = 7.2e-15 Identity = 35/89 (39.33%), Postives = 60/89 (67.42%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.5e-15 Identity = 35/89 (39.33%), Postives = 59/89 (66.29%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy Swiss-Prot
Match: P37842 (Multicystatin OS=Solanum tuberosum OX=4113 PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.4e-13 Identity = 37/95 (38.95%), Postives = 55/95 (57.89%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 73.6 bits (179), Expect = 1.5e-12 Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 7.5e-12 Identity = 40/95 (42.11%), Postives = 53/95 (55.79%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy TrEMBL
Match: A0A0A0KIY5 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G483248 PE=4 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 4.5e-52 Identity = 100/102 (98.04%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy TrEMBL
Match: A0A5A7SJM4 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold253G00050 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 2.6e-44 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy TrEMBL
Match: A0A1S3B2L7 (cysteine proteinase inhibitor 5-like OS=Cucumis melo OX=3656 GN=LOC103485290 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 2.6e-44 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy TrEMBL
Match: A0A0A0KF46 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G483245 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 9.8e-31 Identity = 71/94 (75.53%), Postives = 78/94 (82.98%), Query Frame = 0
BLAST of CSPI06G26330 vs. ExPASy TrEMBL
Match: A0A0A0KF22 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G473520 PE=4 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 1.2e-28 Identity = 69/103 (66.99%), Postives = 81/103 (78.64%), Query Frame = 0
BLAST of CSPI06G26330 vs. NCBI nr
Match: KAE8647459.1 (hypothetical protein Csa_003259 [Cucumis sativus]) HSP 1 Score: 203.4 bits (516), Expect = 9.6e-49 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of CSPI06G26330 vs. NCBI nr
Match: XP_008441065.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis melo] >KAA0025519.1 cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 187.6 bits (475), Expect = 5.5e-44 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of CSPI06G26330 vs. NCBI nr
Match: KAE8647458.1 (hypothetical protein Csa_004041 [Cucumis sativus]) HSP 1 Score: 142.5 bits (358), Expect = 2.0e-30 Identity = 71/94 (75.53%), Postives = 78/94 (82.98%), Query Frame = 0
BLAST of CSPI06G26330 vs. NCBI nr
Match: KAA0040697.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa] >TYK07890.1 cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 131.7 bits (330), Expect = 3.6e-27 Identity = 69/103 (66.99%), Postives = 81/103 (78.64%), Query Frame = 0
BLAST of CSPI06G26330 vs. NCBI nr
Match: KAA0025518.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa] >TYK25673.1 cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 130.2 bits (326), Expect = 1.0e-26 Identity = 64/101 (63.37%), Postives = 76/101 (75.25%), Query Frame = 0
BLAST of CSPI06G26330 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-13 Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 0
BLAST of CSPI06G26330 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 64.3 bits (155), Expect = 6.5e-11 Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 0
BLAST of CSPI06G26330 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-09 Identity = 34/88 (38.64%), Postives = 49/88 (55.68%), Query Frame = 0
BLAST of CSPI06G26330 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 52.0 bits (123), Expect = 3.3e-07 Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 0
BLAST of CSPI06G26330 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 51.6 bits (122), Expect = 4.4e-07 Identity = 29/91 (31.87%), Postives = 49/91 (53.85%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|