CSPI06G26300 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCTTCAGAGCCTGGGGGCTATACTCCAGTTAAGGATCCTCAAAGTCCACGCATGAAAGAATTAGCAGAATGGGCAGTAGCAGAGCACAACAAAAAAGAAGGGACGCACTTGAGGTTTATTAGTATATTGAAGTGTGAGTCGCAAATTGTGAATGGAGTCAACTACCGTTTTACCTTGACGGCTAAGGATGAATCCGATAATTGTCTACCCGGAAACTATATGGCTATTGTCTACGAGCAACTATCTGAGCATCTCAAGGAGCTCGTTTTCTTTAAGCAACTCTTATTGGCCGAATAA ATGGCTTCTTCAGAGCCTGGGGGCTATACTCCAGTTAAGGATCCTCAAAGTCCACGCATGAAAGAATTAGCAGAATGGGCAGTAGCAGAGCACAACAAAAAAGAAGGGACGCACTTGAGGTTTATTAGTATATTGAAGTGTGAGTCGCAAATTGTGAATGGAGTCAACTACCGTTTTACCTTGACGGCTAAGGATGAATCCGATAATTGTCTACCCGGAAACTATATGGCTATTGTCTACGAGCAACTATCTGAGCATCTCAAGGAGCTCGTTTTCTTTAAGCAACTCTTATTGGCCGAATAA ATGGCTTCTTCAGAGCCTGGGGGCTATACTCCAGTTAAGGATCCTCAAAGTCCACGCATGAAAGAATTAGCAGAATGGGCAGTAGCAGAGCACAACAAAAAAGAAGGGACGCACTTGAGGTTTATTAGTATATTGAAGTGTGAGTCGCAAATTGTGAATGGAGTCAACTACCGTTTTACCTTGACGGCTAAGGATGAATCCGATAATTGTCTACCCGGAAACTATATGGCTATTGTCTACGAGCAACTATCTGAGCATCTCAAGGAGCTCGTTTTCTTTAAGCAACTCTTATTGGCCGAATAA MASSEPGGYTPVKDPQSPRMKELAEWAVAEHNKKEGTHLRFISILKCESQIVNGVNYRFTLTAKDESDNCLPGNYMAIVYEQLSEHLKELVFFKQLLLAE* Homology
BLAST of CSPI06G26300 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 1.1e-10 Identity = 30/90 (33.33%), Postives = 59/90 (65.56%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-10 Identity = 30/90 (33.33%), Postives = 58/90 (64.44%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-09 Identity = 30/93 (32.26%), Postives = 60/93 (64.52%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy Swiss-Prot
Match: P37842 (Multicystatin OS=Solanum tuberosum OX=4113 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.8e-09 Identity = 32/92 (34.78%), Postives = 53/92 (57.61%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.2e-08 Identity = 30/93 (32.26%), Postives = 55/93 (59.14%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy TrEMBL
Match: A0A0A0KF46 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G483245 PE=4 SV=1) HSP 1 Score: 205.7 bits (522), Expect = 9.2e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy TrEMBL
Match: A0A5A7TGI6 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold4249G00020 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 4.3e-39 Identity = 82/94 (87.23%), Postives = 87/94 (92.55%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy TrEMBL
Match: A0A0A0KF22 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G473520 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 1.9e-34 Identity = 74/95 (77.89%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy TrEMBL
Match: A0A5A7SJM4 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold253G00050 PE=4 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 1.3e-30 Identity = 71/94 (75.53%), Postives = 78/94 (82.98%), Query Frame = 0
BLAST of CSPI06G26300 vs. ExPASy TrEMBL
Match: A0A1S3B2L7 (cysteine proteinase inhibitor 5-like OS=Cucumis melo OX=3656 GN=LOC103485290 PE=4 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 1.3e-30 Identity = 71/94 (75.53%), Postives = 78/94 (82.98%), Query Frame = 0
BLAST of CSPI06G26300 vs. NCBI nr
Match: KAE8647458.1 (hypothetical protein Csa_004041 [Cucumis sativus]) HSP 1 Score: 205.7 bits (522), Expect = 1.9e-49 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of CSPI06G26300 vs. NCBI nr
Match: KAA0040697.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa] >TYK07890.1 cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 170.2 bits (430), Expect = 8.9e-39 Identity = 82/94 (87.23%), Postives = 87/94 (92.55%), Query Frame = 0
BLAST of CSPI06G26300 vs. NCBI nr
Match: XP_008441065.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis melo] >KAA0025519.1 cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 142.1 bits (357), Expect = 2.6e-30 Identity = 71/94 (75.53%), Postives = 78/94 (82.98%), Query Frame = 0
BLAST of CSPI06G26300 vs. NCBI nr
Match: KAE8647459.1 (hypothetical protein Csa_003259 [Cucumis sativus]) HSP 1 Score: 141.4 bits (355), Expect = 4.4e-30 Identity = 71/94 (75.53%), Postives = 77/94 (81.91%), Query Frame = 0
BLAST of CSPI06G26300 vs. NCBI nr
Match: KAE8645936.1 (hypothetical protein Csa_021372 [Cucumis sativus]) HSP 1 Score: 141.4 bits (355), Expect = 4.4e-30 Identity = 67/85 (78.82%), Postives = 74/85 (87.06%), Query Frame = 0
BLAST of CSPI06G26300 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 30/93 (32.26%), Postives = 60/93 (64.52%), Query Frame = 0
BLAST of CSPI06G26300 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 45.8 bits (107), Expect = 2.3e-05 Identity = 30/90 (33.33%), Postives = 47/90 (52.22%), Query Frame = 0
BLAST of CSPI06G26300 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 42.7 bits (99), Expect = 2.0e-04 Identity = 28/78 (35.90%), Postives = 40/78 (51.28%), Query Frame = 0
BLAST of CSPI06G26300 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 42.7 bits (99), Expect = 2.0e-04 Identity = 28/78 (35.90%), Postives = 40/78 (51.28%), Query Frame = 0
BLAST of CSPI06G26300 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 40.8 bits (94), Expect = 7.6e-04 Identity = 27/93 (29.03%), Postives = 48/93 (51.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|