
CSPI06G25880 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTTTTAATTCGTGATTCTGAACCAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAATAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCTTGGAGCTCACATCCTTCGTAGTATTCTACCAATCTTCTGGTTGA ATGGAATTTTTAATTCGTGATTCTGAACCAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAATAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCTTGGAGCTCACATCCTTCGTAGTATTCTACCAATCTTCTGGTTGA ATGGAATTTTTAATTCGTGATTCTGAACCAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAATAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCTTGGAGCTCACATCCTTCGTAGTATTCTACCAATCTTCTGGTTGA MEFLIRDSEPIVGDYRPCENSDGEHAKEVAQWAVIEYNLKHRHERPYLYLLSVLKCESQVVAGTNWRLGLKCKDENNIEVNCEAVVWEKRWENFLELTSFVVFYQSSG* Homology
BLAST of CSPI06G25880 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 7.9e-12 Identity = 40/88 (45.45%), Postives = 55/88 (62.50%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.0e-11 Identity = 39/88 (44.32%), Postives = 55/88 (62.50%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 63.9 bits (154), Expect = 1.3e-09 Identity = 33/89 (37.08%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 2.0e-07 Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy Swiss-Prot
Match: P31726 (Cystatin-1 OS=Zea mays OX=4577 GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.8e-06 Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy TrEMBL
Match: A0A0A0KF17 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G460000 PE=4 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 4.9e-49 Identity = 93/101 (92.08%), Postives = 95/101 (94.06%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy TrEMBL
Match: A0A0A0KHK7 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G459990 PE=4 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 1.6e-47 Identity = 90/101 (89.11%), Postives = 93/101 (92.08%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy TrEMBL
Match: O80389 (Cystein proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 1.0e-22 Identity = 53/89 (59.55%), Postives = 65/89 (73.03%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy TrEMBL
Match: A0A5A7TBL3 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold529G00310 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.5e-21 Identity = 54/89 (60.67%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of CSPI06G25880 vs. ExPASy TrEMBL
Match: A0A5A7SJM4 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold253G00050 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 1.6e-15 Identity = 45/94 (47.87%), Postives = 57/94 (60.64%), Query Frame = 0
BLAST of CSPI06G25880 vs. NCBI nr
Match: XP_031742547.1 (cysteine proteinase inhibitor 1-like [Cucumis sativus] >KAE8647445.1 hypothetical protein Csa_003720 [Cucumis sativus]) HSP 1 Score: 213.8 bits (543), Expect = 7.5e-52 Identity = 97/100 (97.00%), Postives = 98/100 (98.00%), Query Frame = 0
BLAST of CSPI06G25880 vs. NCBI nr
Match: KGN44121.2 (hypothetical protein Csa_021373 [Cucumis sativus]) HSP 1 Score: 203.0 bits (515), Expect = 1.3e-48 Identity = 93/101 (92.08%), Postives = 94/101 (93.07%), Query Frame = 0
BLAST of CSPI06G25880 vs. NCBI nr
Match: KAE8645927.1 (hypothetical protein Csa_021385 [Cucumis sativus]) HSP 1 Score: 199.1 bits (505), Expect = 1.9e-47 Identity = 91/101 (90.10%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of CSPI06G25880 vs. NCBI nr
Match: KAE8645926.1 (hypothetical protein Csa_021381 [Cucumis sativus]) HSP 1 Score: 197.2 bits (500), Expect = 7.3e-47 Identity = 89/101 (88.12%), Postives = 93/101 (92.08%), Query Frame = 0
BLAST of CSPI06G25880 vs. NCBI nr
Match: KAE8645925.1 (hypothetical protein Csa_021376 [Cucumis sativus]) HSP 1 Score: 196.1 bits (497), Expect = 1.6e-46 Identity = 89/101 (88.12%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of CSPI06G25880 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 63.9 bits (154), Expect = 9.0e-11 Identity = 33/89 (37.08%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of CSPI06G25880 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 50.4 bits (119), Expect = 1.0e-06 Identity = 33/89 (37.08%), Postives = 50/89 (56.18%), Query Frame = 0
BLAST of CSPI06G25880 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 48.9 bits (115), Expect = 3.0e-06 Identity = 31/78 (39.74%), Postives = 42/78 (53.85%), Query Frame = 0
BLAST of CSPI06G25880 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 48.1 bits (113), Expect = 5.1e-06 Identity = 35/89 (39.33%), Postives = 47/89 (52.81%), Query Frame = 0
BLAST of CSPI06G25880 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 48.1 bits (113), Expect = 5.1e-06 Identity = 35/89 (39.33%), Postives = 47/89 (52.81%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|