
CSPI05G06950 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAACCAAATATTCCATCATAATTGTCGGTGACAACTTCGGTTGTGGTTCTTCACGGGAGCACGTGCCGGTTGCATTGGGAGTGTCCGACGCCGTGGCGGTAGTGGCTGAATCTTATGCGCATATTTTCCTCACAGCAAACTCCATGGCAACCAGAGAGATTTATCCATTGGAATCAGAGACTAGGATTTCACGTATTTTAAAATTAAACAATAATAATAATAACTAG ATGAAAACCAAATATTCCATCATAATTGTCGGTGACAACTTCGGTTGTGGTTCTTCACGGGAGCACGTGCCGGTTGCATTGGGAGTGTCCGACGCCGTGGCGGTAGTGGCTGAATCTTATGCGCATATTTTCCTCACAGCAAACTCCATGGCAACCAGAGAGATTTATCCATTGGAATCAGAGACTAGGATTTCACGTATTTTAAAATTAAACAATAATAATAATAACTAG ATGAAAACCAAATATTCCATCATAATTGTCGGTGACAACTTCGGTTGTGGTTCTTCACGGGAGCACGTGCCGGTTGCATTGGGAGTGTCCGACGCCGTGGCGGTAGTGGCTGAATCTTATGCGCATATTTTCCTCACAGCAAACTCCATGGCAACCAGAGAGATTTATCCATTGGAATCAGAGACTAGGATTTCACGTATTTTAAAATTAAACAATAATAATAATAACTAG MKTKYSIIIVGDNFGCGSSREHVPVALGVSDAVAVVAESYAHIFLTANSMATREIYPLESETRISRILKLNNNNNN* Homology
BLAST of CSPI05G06950 vs. ExPASy Swiss-Prot
Match: Q9ZW85 (3-isopropylmalate dehydratase small subunit 1 OS=Arabidopsis thaliana OX=3702 GN=SSU1 PE=1 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-17 Identity = 45/64 (70.31%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy Swiss-Prot
Match: Q9LYT7 (3-isopropylmalate dehydratase small subunit 3 OS=Arabidopsis thaliana OX=3702 GN=SSU3 PE=1 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.0e-17 Identity = 46/64 (71.88%), Postives = 51/64 (79.69%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy Swiss-Prot
Match: Q9ZW84 (3-isopropylmalate dehydratase small subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SSU2 PE=1 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 2.9e-16 Identity = 42/63 (66.67%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy Swiss-Prot
Match: Q7M887 (3-isopropylmalate dehydratase small subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) OX=273121 GN=leuD PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.2e-07 Identity = 25/42 (59.52%), Postives = 31/42 (73.81%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy Swiss-Prot
Match: A8ETJ8 (3-isopropylmalate dehydratase small subunit OS=Arcobacter butzleri (strain RM4018) OX=367737 GN=leuD PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 9.2e-07 Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy TrEMBL
Match: A0A0A0KPA8 (Aconitase_C domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G162650 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 5.6e-31 Identity = 73/76 (96.05%), Postives = 74/76 (97.37%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy TrEMBL
Match: A0A5A7T900 (3-isopropylmalate dehydratase small subunit 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold558G00620 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 6.4e-19 Identity = 54/64 (84.38%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy TrEMBL
Match: A0A0A0KPB2 (Aconitase_C domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G165170 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 6.4e-19 Identity = 54/64 (84.38%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy TrEMBL
Match: A0A1S3AT32 (3-isopropylmalate dehydratase small subunit 3-like OS=Cucumis melo OX=3656 GN=LOC103482595 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 6.4e-19 Identity = 54/64 (84.38%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of CSPI05G06950 vs. ExPASy TrEMBL
Match: A0A6J1ID74 (3-isopropylmalate dehydratase small subunit 3-like OS=Cucurbita maxima OX=3661 GN=LOC111471515 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 3.2e-18 Identity = 53/64 (82.81%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CSPI05G06950 vs. NCBI nr
Match: XP_004152394.1 (3-isopropylmalate dehydratase small subunit 3 [Cucumis sativus] >KGN50272.1 hypothetical protein Csa_000662 [Cucumis sativus]) HSP 1 Score: 102.8 bits (255), Expect = 1.3e-18 Identity = 54/64 (84.38%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of CSPI05G06950 vs. NCBI nr
Match: XP_038876127.1 (3-isopropylmalate dehydratase small subunit 1-like [Benincasa hispida]) HSP 1 Score: 102.8 bits (255), Expect = 1.3e-18 Identity = 54/64 (84.38%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of CSPI05G06950 vs. NCBI nr
Match: XP_008437054.1 (PREDICTED: 3-isopropylmalate dehydratase small subunit 3-like [Cucumis melo] >KAA0039730.1 3-isopropylmalate dehydratase small subunit 3-like [Cucumis melo var. makuwa]) HSP 1 Score: 102.8 bits (255), Expect = 1.3e-18 Identity = 54/64 (84.38%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of CSPI05G06950 vs. NCBI nr
Match: XP_022922281.1 (3-isopropylmalate dehydratase small subunit 3-like [Cucurbita moschata]) HSP 1 Score: 100.5 bits (249), Expect = 6.6e-18 Identity = 53/64 (82.81%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CSPI05G06950 vs. NCBI nr
Match: XP_022972989.1 (3-isopropylmalate dehydratase small subunit 3-like [Cucurbita maxima]) HSP 1 Score: 100.5 bits (249), Expect = 6.6e-18 Identity = 53/64 (82.81%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CSPI05G06950 vs. TAIR 10
Match: AT2G43090.1 (Aconitase/3-isopropylmalate dehydratase protein ) HSP 1 Score: 90.1 bits (222), Expect = 8.3e-19 Identity = 45/64 (70.31%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of CSPI05G06950 vs. TAIR 10
Match: AT3G58990.1 (isopropylmalate isomerase 1 ) HSP 1 Score: 89.4 bits (220), Expect = 1.4e-18 Identity = 46/64 (71.88%), Postives = 51/64 (79.69%), Query Frame = 0
BLAST of CSPI05G06950 vs. TAIR 10
Match: AT2G43100.1 (isopropylmalate isomerase 2 ) HSP 1 Score: 85.5 bits (210), Expect = 2.0e-17 Identity = 42/63 (66.67%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of CSPI05G06950 vs. TAIR 10
Match: AT2G43090.2 (Aconitase/3-isopropylmalate dehydratase protein ) HSP 1 Score: 42.4 bits (98), Expect = 2.0e-04 Identity = 22/37 (59.46%), Postives = 28/37 (75.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|