
CSPI03G28420 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGCCTCATAAACAATTCCTTTGGAGATTCTTTCCTTTCTCCACTCCCTTAATGTTTCACATGCTTCCTTTTTCCAGTAGACAATCCATAGAGTCTTTTGCCACTTTGGGATCGGTCTCATTGAGCTCATCACAAGTTTTGCCAGCATATTCTTCGAATTTTCTTTTAGAATCTGTAGACTATGTTAAACTGGTTCAATCAGCTACTAAAACTGGGAAGTTGAACCATGGCAAACTCGTTCATTCCCATATGATTAGAACTTCTTTCAGGCTCTGTCTATTTTTGCAGAACAATCTTCTTAACGTGTACTGCAAATGTGGGGATACACGTTCTGCTGACAAATTGTTTGATAAAATGTCAAAATCAAACATTGTAACTTACAACTCTTTGATTTCTGGCCCTTGACAAGGTCATGATTTTGTTTGATAAAGCAAGAAGACTTGGTTTGAAACTTGATAAGTACAATTGTGCAGGAGCTCTTACAGCATGTAGTCAAAGGAGACTGACTTGATTATTTGAAAGAGTTCTTATTCAATCAAATCTATCCATGCATAAAGAGGACTAGAAAATTAGTGGTGACAATGCATAATATCATCTTTCATTAGTCGATCAGTAGTTAATTATACTAATCCAAATCCAAAAATTAGCTTCTAGATTTATGTAATTCAAAAGCAAAAGAAATAGAAATAATTAGACAATGAATTAAACCGATAAAATTGATAATTGATTCAAACATATTGCAATGTTTTTAATTCTCAACTTTTGTAAATTCGATTTTAAATAGGAAGCAAACGTAAACCGAAGCGTTCTAATAATATATTATTTATTTACTCTAAAAGTTAAAAGGGAATTCTCCTTCCTTTTGATTTTAGGTTACACAGCTTGGTGAAGACTCATATTGGGGAGCCATTTGTGAAACTGAGAATTCCTATTTCTTTCACTTCTCTCGGAATTCCATTGATTTGTGCACCAGTAAAGTCCTCCAGATCAGTCTCGCCACTATATTAGGCTAA ATGTTGCCTCATAAACAATTCCTTTGGAGATTCTTTCCTTTCTCCACTCCCTTAATGTTTCACATGCTTCCTTTTTCCAGTAGACAATCCATAGAGTCTTTTGCCACTTTGGGATCGGTCTCATTGAGCTCATCACAAGTTTTGCCAGCATATTCTTCGAATTTTCTTTTAGAATCTGTAGACTATGTTAAACTGGTTCAATCAGCTACTAAAACTGGGAAGTTGAACCATGGCAAACTCGTTCATTCCCATATGATTAGAACTTCTTTCAGGCTCTGTCTATTTTTGCAGAACAATCTTCTTAACGTGTACTGCAAATGTGGGGATACACGTTCTGCTGACAAATTGTTTGATAAAATGTCAAAATCAAACATTGTTACACAGCTTGGTGAAGACTCATATTGGGGAGCCATTTGTGAAACTGAGAATTCCTATTTCTTTCACTTCTCTCGGAATTCCATTGATTTGTGCACCAGTAAAGTCCTCCAGATCAGTCTCGCCACTATATTAGGCTAA ATGTTGCCTCATAAACAATTCCTTTGGAGATTCTTTCCTTTCTCCACTCCCTTAATGTTTCACATGCTTCCTTTTTCCAGTAGACAATCCATAGAGTCTTTTGCCACTTTGGGATCGGTCTCATTGAGCTCATCACAAGTTTTGCCAGCATATTCTTCGAATTTTCTTTTAGAATCTGTAGACTATGTTAAACTGGTTCAATCAGCTACTAAAACTGGGAAGTTGAACCATGGCAAACTCGTTCATTCCCATATGATTAGAACTTCTTTCAGGCTCTGTCTATTTTTGCAGAACAATCTTCTTAACGTGTACTGCAAATGTGGGGATACACGTTCTGCTGACAAATTGTTTGATAAAATGTCAAAATCAAACATTGTTACACAGCTTGGTGAAGACTCATATTGGGGAGCCATTTGTGAAACTGAGAATTCCTATTTCTTTCACTTCTCTCGGAATTCCATTGATTTGTGCACCAGTAAAGTCCTCCAGATCAGTCTCGCCACTATATTAGGCTAA MLPHKQFLWRFFPFSTPLMFHMLPFSSRQSIESFATLGSVSLSSSQVLPAYSSNFLLESVDYVKLVQSATKTGKLNHGKLVHSHMIRTSFRLCLFLQNNLLNVYCKCGDTRSADKLFDKMSKSNIVTQLGEDSYWGAICETENSYFFHFSRNSIDLCTSKVLQISLATILG* Homology
BLAST of CSPI03G28420 vs. ExPASy Swiss-Prot
Match: Q9LRV9 (Pentatricopeptide repeat-containing protein At3g13880 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E89 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 2.5e-12 Identity = 43/114 (37.72%), Postives = 64/114 (56.14%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy Swiss-Prot
Match: Q9LIQ7 (Pentatricopeptide repeat-containing protein At3g24000, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-H87 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 5.4e-07 Identity = 25/66 (37.88%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy Swiss-Prot
Match: A8MQA3 (Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H28 PE=2 SV=2) HSP 1 Score: 55.5 bits (132), Expect = 7.1e-07 Identity = 32/98 (32.65%), Postives = 59/98 (60.20%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy Swiss-Prot
Match: Q9ZUT4 (Pentatricopeptide repeat-containing protein At2g37320 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E50 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 1.2e-06 Identity = 21/66 (31.82%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy Swiss-Prot
Match: Q9LYU9 (Pentatricopeptide repeat-containing protein At5g13270, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H90 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 3.5e-06 Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy TrEMBL
Match: A0A0A0LBY6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G645920 PE=4 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 2.0e-60 Identity = 128/163 (78.53%), Postives = 128/163 (78.53%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy TrEMBL
Match: A0A0A0KSU3 (DYW_deaminase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G648690 PE=3 SV=1) HSP 1 Score: 241.1 bits (614), Expect = 3.4e-60 Identity = 121/127 (95.28%), Postives = 123/127 (96.85%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy TrEMBL
Match: A0A1S3CAH5 (pentatricopeptide repeat-containing protein At3g13880 OS=Cucumis melo OX=3656 GN=LOC103498661 PE=3 SV=1) HSP 1 Score: 221.1 bits (562), Expect = 3.6e-54 Identity = 112/127 (88.19%), Postives = 116/127 (91.34%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy TrEMBL
Match: A0A5D3BP01 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold169G00900 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 3.7e-43 Identity = 95/106 (89.62%), Postives = 98/106 (92.45%), Query Frame = 0
BLAST of CSPI03G28420 vs. ExPASy TrEMBL
Match: A0A6J1I7D1 (pentatricopeptide repeat-containing protein At3g13880 OS=Cucurbita maxima OX=3661 GN=LOC111471935 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 1.5e-39 Identity = 90/127 (70.87%), Postives = 97/127 (76.38%), Query Frame = 0
BLAST of CSPI03G28420 vs. NCBI nr
Match: XP_031741772.1 (pentatricopeptide repeat-containing protein At3g13880 [Cucumis sativus]) HSP 1 Score: 241.1 bits (614), Expect = 7.0e-60 Identity = 121/127 (95.28%), Postives = 123/127 (96.85%), Query Frame = 0
BLAST of CSPI03G28420 vs. NCBI nr
Match: XP_008459568.1 (PREDICTED: pentatricopeptide repeat-containing protein At3g13880 [Cucumis melo]) HSP 1 Score: 221.1 bits (562), Expect = 7.5e-54 Identity = 112/127 (88.19%), Postives = 116/127 (91.34%), Query Frame = 0
BLAST of CSPI03G28420 vs. NCBI nr
Match: XP_038889992.1 (pentatricopeptide repeat-containing protein At3g13880 [Benincasa hispida] >XP_038889993.1 pentatricopeptide repeat-containing protein At3g13880 [Benincasa hispida] >XP_038889994.1 pentatricopeptide repeat-containing protein At3g13880 [Benincasa hispida] >XP_038889995.1 pentatricopeptide repeat-containing protein At3g13880 [Benincasa hispida]) HSP 1 Score: 198.7 bits (504), Expect = 4.0e-47 Identity = 101/127 (79.53%), Postives = 108/127 (85.04%), Query Frame = 0
BLAST of CSPI03G28420 vs. NCBI nr
Match: KAE8648993.1 (hypothetical protein Csa_009190 [Cucumis sativus]) HSP 1 Score: 198.4 bits (503), Expect = 5.2e-47 Identity = 101/106 (95.28%), Postives = 103/106 (97.17%), Query Frame = 0
BLAST of CSPI03G28420 vs. NCBI nr
Match: KAA0039298.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa] >TYK00482.1 pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 184.5 bits (467), Expect = 7.7e-43 Identity = 95/106 (89.62%), Postives = 98/106 (92.45%), Query Frame = 0
BLAST of CSPI03G28420 vs. TAIR 10
Match: AT3G13880.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 73.6 bits (179), Expect = 1.8e-13 Identity = 43/114 (37.72%), Postives = 64/114 (56.14%), Query Frame = 0
BLAST of CSPI03G28420 vs. TAIR 10
Match: AT3G24000.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 55.8 bits (133), Expect = 3.9e-08 Identity = 25/66 (37.88%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of CSPI03G28420 vs. TAIR 10
Match: AT4G21065.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 55.5 bits (132), Expect = 5.0e-08 Identity = 32/98 (32.65%), Postives = 59/98 (60.20%), Query Frame = 0
BLAST of CSPI03G28420 vs. TAIR 10
Match: AT2G37320.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 54.7 bits (130), Expect = 8.6e-08 Identity = 21/66 (31.82%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of CSPI03G28420 vs. TAIR 10
Match: AT5G13270.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 53.1 bits (126), Expect = 2.5e-07 Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|