CSPI03G26540 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTCATTCGCAGGTTCCAATGCTTAAAGAATTTGAAGAGGAGAAGTTAGAAGAGGTGATGAAGGATATGAAGCCAATGGTTTTTGCAGAGTATAGCTATATTATTCGAGAGGGGGAGCGTGTTGAGCAGATGCTACTATTCACGAAAGGTATGGGATTGAAATTTAGCAAGAGCACTGGAGCTAGAACAACGATTAGCACTTTTGGAAAAGGTGATTTATTTGGGGAGCAGCTACTGATTTGGGCAGTGGAAAATCTTCATGTGTCTGAAATTCCTTTGTTCGAATGTACACTCAAGACACAGACCCAAATGGAAGCCTTCACTCTTAAGGCTATTGATCCACAATATCATATCATACCAAGTGGGACATAA ATGTTTCATTCGCAGGTTCCAATGCTTAAAGAATTTGAAGAGGAGAAGTTAGAAGAGGTGATGAAGGATATGAAGCCAATGGTTTTTGCAGAGTATAGCTATATTATTCGAGAGGGGGAGCGTGTTGAGCAGATGCTACTATTCACGAAAGGTATGGGATTGAAATTTAGCAAGAGCACTGGAGCTAGAACAACGATTAGCACTTTTGGAAAAGGTGATTTATTTGGGGAGCAGCTACTGATTTGGGCAGTGGAAAATCTTCATGTGTCTGAAATTCCTTTGTTCGAATGTACACTCAAGACACAGACCCAAATGGAAGCCTTCACTCTTAAGGCTATTGATCCACAATATCATATCATACCAAGTGGGACATAA ATGTTTCATTCGCAGGTTCCAATGCTTAAAGAATTTGAAGAGGAGAAGTTAGAAGAGGTGATGAAGGATATGAAGCCAATGGTTTTTGCAGAGTATAGCTATATTATTCGAGAGGGGGAGCGTGTTGAGCAGATGCTACTATTCACGAAAGGTATGGGATTGAAATTTAGCAAGAGCACTGGAGCTAGAACAACGATTAGCACTTTTGGAAAAGGTGATTTATTTGGGGAGCAGCTACTGATTTGGGCAGTGGAAAATCTTCATGTGTCTGAAATTCCTTTGTTCGAATGTACACTCAAGACACAGACCCAAATGGAAGCCTTCACTCTTAAGGCTATTGATCCACAATATCATATCATACCAAGTGGGACATAA MFHSQVPMLKEFEEEKLEEVMKDMKPMVFAEYSYIIREGERVEQMLLFTKGMGLKFSKSTGARTTISTFGKGDLFGEQLLIWAVENLHVSEIPLFECTLKTQTQMEAFTLKAIDPQYHIIPSGT* Homology
BLAST of CSPI03G26540 vs. ExPASy Swiss-Prot
Match: O65717 (Cyclic nucleotide-gated ion channel 1 OS=Arabidopsis thaliana OX=3702 GN=CNGC1 PE=1 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.1e-12 Identity = 38/115 (33.04%), Postives = 71/115 (61.74%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy Swiss-Prot
Match: Q9S9N5 (Putative cyclic nucleotide-gated ion channel 7 OS=Arabidopsis thaliana OX=3702 GN=CNGC7 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.7e-10 Identity = 38/111 (34.23%), Postives = 64/111 (57.66%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy Swiss-Prot
Match: O82226 (Probable cyclic nucleotide-gated ion channel 6 OS=Arabidopsis thaliana OX=3702 GN=CNGC6 PE=1 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 2.2e-10 Identity = 38/111 (34.23%), Postives = 64/111 (57.66%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy Swiss-Prot
Match: Q9FXH6 (Putative cyclic nucleotide-gated ion channel 8 OS=Arabidopsis thaliana OX=3702 GN=CNGC8 PE=3 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 2.2e-10 Identity = 38/111 (34.23%), Postives = 64/111 (57.66%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy Swiss-Prot
Match: Q9LD40 (Putative cyclic nucleotide-gated ion channel 13 OS=Arabidopsis thaliana OX=3702 GN=CNGC13 PE=3 SV=2) HSP 1 Score: 65.9 bits (159), Expect = 3.8e-10 Identity = 40/113 (35.40%), Postives = 62/113 (54.87%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy TrEMBL
Match: A0A5D3E6K4 (Cyclic nucleotide-gated ion channel 1-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold788G00140 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 3.2e-44 Identity = 94/114 (82.46%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy TrEMBL
Match: A0A1S4DYA3 (cyclic nucleotide-gated ion channel 1-like isoform X3 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 4.2e-44 Identity = 95/114 (83.33%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy TrEMBL
Match: A0A5A7V0L3 (Cyclic nucleotide-gated ion channel 1-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold212G00660 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 4.2e-44 Identity = 95/114 (83.33%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy TrEMBL
Match: A0A5D3DCD7 (Cyclic nucleotide-gated ion channel 1-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold75860G00390 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 4.2e-44 Identity = 95/114 (83.33%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. ExPASy TrEMBL
Match: A0A1S3BLM4 (cyclic nucleotide-gated ion channel 1-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 4.2e-44 Identity = 95/114 (83.33%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. NCBI nr
Match: KAE8650811.1 (hypothetical protein Csa_017590, partial [Cucumis sativus]) HSP 1 Score: 243.0 bits (619), Expect = 1.3e-60 Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = 0
BLAST of CSPI03G26540 vs. NCBI nr
Match: TYK31713.1 (cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 187.6 bits (475), Expect = 6.6e-44 Identity = 94/114 (82.46%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. NCBI nr
Match: XP_016900693.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis melo] >TYK21168.1 cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 187.2 bits (474), Expect = 8.7e-44 Identity = 95/114 (83.33%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. NCBI nr
Match: XP_008449547.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis melo]) HSP 1 Score: 187.2 bits (474), Expect = 8.7e-44 Identity = 95/114 (83.33%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. NCBI nr
Match: XP_016900694.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo] >XP_016900695.1 PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo]) HSP 1 Score: 187.2 bits (474), Expect = 8.7e-44 Identity = 95/114 (83.33%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of CSPI03G26540 vs. TAIR 10
Match: AT5G53130.1 (cyclic nucleotide gated channel 1 ) HSP 1 Score: 74.3 bits (181), Expect = 7.6e-14 Identity = 38/115 (33.04%), Postives = 71/115 (61.74%), Query Frame = 0
BLAST of CSPI03G26540 vs. TAIR 10
Match: AT1G15990.1 (cyclic nucleotide gated channel 7 ) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-11 Identity = 38/111 (34.23%), Postives = 64/111 (57.66%), Query Frame = 0
BLAST of CSPI03G26540 vs. TAIR 10
Match: AT1G19780.1 (cyclic nucleotide gated channel 8 ) HSP 1 Score: 66.6 bits (161), Expect = 1.6e-11 Identity = 38/111 (34.23%), Postives = 64/111 (57.66%), Query Frame = 0
BLAST of CSPI03G26540 vs. TAIR 10
Match: AT2G23980.1 (cyclic nucleotide-gated channel 6 ) HSP 1 Score: 66.6 bits (161), Expect = 1.6e-11 Identity = 38/111 (34.23%), Postives = 64/111 (57.66%), Query Frame = 0
BLAST of CSPI03G26540 vs. TAIR 10
Match: AT2G28260.1 (cyclic nucleotide-gated channel 15 ) HSP 1 Score: 65.9 bits (159), Expect = 2.7e-11 Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|