CSPI01G18450 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTTCCGTTGTATTTGAAAATTACAATGATGCTGATTGGAACTCCCTCTCAGATGATTTAAAGGTTACAAGTGGCTATATTTTTAATATAGCAGGAGGAGCTGTTGCTTGGAAATTCAAGAAACAGACCATCTTGGCCCAGTCAACGATGAAGTCTGAAATGATTGCACTAGCTACTTCTAGTGAAGAAGCAAGTTGGCTTCGAAGCTTGCTATAA TTTTCCGTTGTATTTGAAAATTACAATGATGCTGATTGGAACTCCCTCTCAGATGATTTAAAGGTTACAAGTGGCTATATTTTTAATATAGCAGGAGGAGCTGTTGCTTGGAAATTCAAGAAACAGACCATCTTGGCCCAGTCAACGATGAAGTCTGAAATGATTGCACTAGCTACTTCTAGTGAAGAAGCAAGTTGGCTTCGAAGCTTGCTATAA TTTTCCGTTGTATTTGAAAATTACAATGATGCTGATTGGAACTCCCTCTCAGATGATTTAAAGGTTACAAGTGGCTATATTTTTAATATAGCAGGAGGAGCTGTTGCTTGGAAATTCAAGAAACAGACCATCTTGGCCCAGTCAACGATGAAGTCTGAAATGATTGCACTAGCTACTTCTAGTGAAGAAGCAAGTTGGCTTCGAAGCTTGCTATAA FSVVFENYNDADWNSLSDDLKVTSGYIFNIAGGAVAWKFKKQTILAQSTMKSEMIALATSSEEASWLRSLL* Homology
BLAST of CSPI01G18450 vs. ExPASy Swiss-Prot
Match: P0CV72 (Secreted RxLR effector protein 161 OS=Plasmopara viticola OX=143451 GN=RXLR161 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.1e-08 Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.6e-07 Identity = 25/68 (36.76%), Postives = 41/68 (60.29%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.6e-06 Identity = 24/64 (37.50%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-05 Identity = 24/64 (37.50%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy TrEMBL
Match: A0A445M2H4 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Glycine soja OX=3848 GN=D0Y65_001367 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 2.1e-24 Identity = 59/71 (83.10%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy TrEMBL
Match: A0A5D3DJH9 (Putative polyprotein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1607G00620 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.1e-23 Identity = 58/71 (81.69%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy TrEMBL
Match: A0A5D3BGA0 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold369G00230 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.1e-23 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy TrEMBL
Match: A0A6A4PET0 (Putative RNA-directed DNA polymerase OS=Lupinus albus OX=3870 GN=Lalb_Chr15g0086811 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 5.2e-23 Identity = 57/71 (80.28%), Postives = 64/71 (90.14%), Query Frame = 0
BLAST of CSPI01G18450 vs. ExPASy TrEMBL
Match: A0A6A4MUS8 (Putative RNA-directed DNA polymerase OS=Lupinus albus OX=3870 GN=Lalb_Chr00c59g0413801 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 5.2e-23 Identity = 57/71 (80.28%), Postives = 64/71 (90.14%), Query Frame = 0
BLAST of CSPI01G18450 vs. NCBI nr
Match: RZC29738.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Glycine soja]) HSP 1 Score: 120.9 bits (302), Expect = 4.4e-24 Identity = 59/71 (83.10%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of CSPI01G18450 vs. NCBI nr
Match: KAA0058878.1 (putative polyprotein [Cucumis melo var. makuwa] >TYK23745.1 putative polyprotein [Cucumis melo var. makuwa]) HSP 1 Score: 117.1 bits (292), Expect = 6.3e-23 Identity = 58/71 (81.69%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CSPI01G18450 vs. NCBI nr
Match: TYJ98069.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 117.1 bits (292), Expect = 6.3e-23 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CSPI01G18450 vs. NCBI nr
Match: KAE9584075.1 (putative RNA-directed DNA polymerase [Lupinus albus]) HSP 1 Score: 116.3 bits (290), Expect = 1.1e-22 Identity = 57/71 (80.28%), Postives = 64/71 (90.14%), Query Frame = 0
BLAST of CSPI01G18450 vs. NCBI nr
Match: KAE9598987.1 (putative RNA-directed DNA polymerase [Lupinus albus]) HSP 1 Score: 116.3 bits (290), Expect = 1.1e-22 Identity = 57/71 (80.28%), Postives = 64/71 (90.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|