Bhi12G001577 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTAATATTTACAACGCTTTGATAGTGAAAGGTCGAGATACTGCCGGTCAAGAAATTAATGTGACTTGTGAAGTACAGCAATTATTAGGAAATAATCGAGTTAGAGCTGTAGCTATGAGTGCTACAGATGGTCTAATGAGAGGAATGGAAGTGATTGACACGAGAGCTCCTCTAAGTGTTCCAGTCGGCGGAACGACTGAAGGCCGAATTTTCAACGTGCTTGGAGAGCCTATTGATAATTTGGGTCCTGTAGATACTCGCACAACATCTCCTATTCATAGATCCGCCCCCGCTTTTATTTATTTTATACAGTTAGATAAAAAATTCTCGATTTTGGAAACAGGAATTAAAGTAGTAGATCTTTTAGCCCTTATCGACGTGGAGGAAAAATAG ATGCCTAATATTTACAACGCTTTGATAGTGAAAGGTCGAGATACTGCCGGTCAAGAAATTAATGTGACTTGTGAAGTACAGCAATTATTAGGAAATAATCGAGTTAGAGCTGTAGCTATGAGTGCTACAGATGGTCTAATGAGAGGAATGGAAGTGATTGACACGAGAGCTCCTCTAAGTGTTCCAGTCGGCGGAACGACTGAAGGCCGAATTTTCAACGTGCTTGGAGAGCCTATTGATAATTTGGGTCCTGTAGATACTCGCACAACATCTCCTATTCATAGATCCGCCCCCGCTTTTATTTATTTTATACAGTTAGATAAAAAATTCTCGATTTTGGAAACAGGAATTAAAGTAGTAGATCTTTTAGCCCTTATCGACGTGGAGGAAAAATAG ATGCCTAATATTTACAACGCTTTGATAGTGAAAGGTCGAGATACTGCCGGTCAAGAAATTAATGTGACTTGTGAAGTACAGCAATTATTAGGAAATAATCGAGTTAGAGCTGTAGCTATGAGTGCTACAGATGGTCTAATGAGAGGAATGGAAGTGATTGACACGAGAGCTCCTCTAAGTGTTCCAGTCGGCGGAACGACTGAAGGCCGAATTTTCAACGTGCTTGGAGAGCCTATTGATAATTTGGGTCCTGTAGATACTCGCACAACATCTCCTATTCATAGATCCGCCCCCGCTTTTATTTATTTTATACAGTTAGATAAAAAATTCTCGATTTTGGAAACAGGAATTAAAGTAGTAGATCTTTTAGCCCTTATCGACGTGGAGGAAAAATAG MPNIYNALIVKGRDTAGQEINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTRAPLSVPVGGTTEGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIYFIQLDKKFSILETGIKVVDLLALIDVEEK Homology
BLAST of Bhi12G001577 vs. TAIR 10
Match: ATCG00480.1 (ATP synthase subunit beta ) HSP 1 Score: 206.1 bits (523), Expect = 1.8e-53 Identity = 104/124 (83.87%), Postives = 111/124 (89.52%), Query Frame = 0
BLAST of Bhi12G001577 vs. TAIR 10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 104.0 bits (258), Expect = 9.4e-23 Identity = 61/124 (49.19%), Postives = 75/124 (60.48%), Query Frame = 0
BLAST of Bhi12G001577 vs. TAIR 10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 104.0 bits (258), Expect = 9.4e-23 Identity = 61/124 (49.19%), Postives = 75/124 (60.48%), Query Frame = 0
BLAST of Bhi12G001577 vs. TAIR 10
Match: AT5G08690.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 104.0 bits (258), Expect = 9.4e-23 Identity = 61/124 (49.19%), Postives = 75/124 (60.48%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy Swiss-Prot
Match: Q6QBP2 (ATP synthase subunit beta, chloroplastic OS=Castanea sativa OX=21020 GN=atpB PE=3 SV=1) HSP 1 Score: 219.2 bits (557), Expect = 2.8e-56 Identity = 112/124 (90.32%), Postives = 115/124 (92.74%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy Swiss-Prot
Match: Q9BA85 (ATP synthase subunit beta, chloroplastic OS=Nypa fruticans OX=4718 GN=atpB PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 4.8e-56 Identity = 112/124 (90.32%), Postives = 114/124 (91.94%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy Swiss-Prot
Match: A6MM43 (ATP synthase subunit beta, chloroplastic OS=Buxus microphylla OX=153571 GN=atpB PE=3 SV=1) HSP 1 Score: 218.0 bits (554), Expect = 6.3e-56 Identity = 111/124 (89.52%), Postives = 114/124 (91.94%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy Swiss-Prot
Match: Q09X10 (ATP synthase subunit beta, chloroplastic OS=Morus indica OX=248361 GN=atpB PE=3 SV=1) HSP 1 Score: 218.0 bits (554), Expect = 6.3e-56 Identity = 112/124 (90.32%), Postives = 114/124 (91.94%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy Swiss-Prot
Match: Q7HDI4 (ATP synthase subunit beta, chloroplastic OS=Acrocomia aculeata OX=169987 GN=atpB PE=3 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 8.2e-56 Identity = 111/124 (89.52%), Postives = 114/124 (91.94%), Query Frame = 0
BLAST of Bhi12G001577 vs. NCBI nr
Match: YP_010131101.1 (ATP synthase CF1 beta subunit [Benincasa hispida] >QPZ75748.1 ATP synthase CF1 beta subunit [Benincasa hispida] >QSQ72317.1 CF1 subunit beta [Benincasa hispida]) HSP 1 Score: 224.6 bits (571), Expect = 5.1e-55 Identity = 116/124 (93.55%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. NCBI nr
Match: YP_009752082.1 (CF1 subunit beta [Dendrosicyos socotranus] >YP_009753096.1 CF1 subunit beta [Corallocarpus boehmii] >QIT05492.1 CF1 subunit beta [Dendrosicyos socotranus] >QIT06168.1 CF1 subunit beta [Corallocarpus boehmii]) HSP 1 Score: 223.8 bits (569), Expect = 8.8e-55 Identity = 115/124 (92.74%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. NCBI nr
Match: AAY44151.1 (ATP synthase beta subunit, partial [Dendrosicyos socotranus]) HSP 1 Score: 223.8 bits (569), Expect = 8.8e-55 Identity = 115/124 (92.74%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. NCBI nr
Match: AAY44153.1 (ATP synthase beta subunit, partial [Gurania tubulosa]) HSP 1 Score: 223.8 bits (569), Expect = 8.8e-55 Identity = 115/124 (92.74%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. NCBI nr
Match: CAB90104.1 (ATP synthase beta subunit, partial [Kedrostis nana]) HSP 1 Score: 222.6 bits (566), Expect = 2.0e-54 Identity = 114/124 (91.94%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy TrEMBL
Match: A0A7T3QNS7 (ATP synthase CF1 beta subunit OS=Benincasa hispida OX=102211 GN=atpB PE=4 SV=1) HSP 1 Score: 224.6 bits (571), Expect = 2.5e-55 Identity = 116/124 (93.55%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy TrEMBL
Match: A0A6H0EV22 (ATP synthase subunit beta, chloroplastic OS=Corallocarpus boehmii OX=386154 GN=atpB PE=3 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 4.2e-55 Identity = 115/124 (92.74%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy TrEMBL
Match: Q29S91 (ATP synthase subunit beta (Fragment) OS=Gurania tubulosa OX=328385 GN=atpB PE=3 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 4.2e-55 Identity = 115/124 (92.74%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy TrEMBL
Match: A0A6H0ET20 (ATP synthase subunit beta, chloroplastic OS=Dendrosicyos socotranus OX=229694 GN=atpB PE=3 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 4.2e-55 Identity = 115/124 (92.74%), Postives = 117/124 (94.35%), Query Frame = 0
BLAST of Bhi12G001577 vs. ExPASy TrEMBL
Match: Q29S93 (ATP synthase subunit beta (Fragment) OS=Dendrosicyos socotranus OX=229694 GN=atpB PE=3 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 4.2e-55 Identity = 115/124 (92.74%), Postives = 117/124 (94.35%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|