Bhi12G001303 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGATACAGATCAAGAAATTGAATTTCAATTATTTGTGGTGGTAGAACCATTGATAAAAGAAAGAGATGCTGTATATGAATCACTACCGGGGTCCCCGGCCAGAACCACACGTGCAAGTTTCCCTACATGTGGCTCATCCGTGCTTTTCGAGGCGCTGCCTGTGACTCAGCATGGGAGAAGGGGGCGGAACTGCACACTTTCGTGTTCAGAGCATTGTCCGAGTGAATAG ATGGAAGATACAGATCAAGAAATTGAATTTCAATTATTTGTGGTGGTAGAACCATTGATAAAAGAAAGAGATGCTGTATATGAATCACTACCGGGGTCCCCGGCCAGAACCACACGTGCAAGTTTCCCTACATGTGGCTCATCCGTGCTTTTCGAGGCGCTGCCTGTGACTCAGCATGGGAGAAGGGGGCGGAACTGCACACTTTCGTGTTCAGAGCATTGTCCGAGTGAATAG ATGGAAGATACAGATCAAGAAATTGAATTTCAATTATTTGTGGTGGTAGAACCATTGATAAAAGAAAGAGATGCTGTATATGAATCACTACCGGGGTCCCCGGCCAGAACCACACGTGCAAGTTTCCCTACATGTGGCTCATCCGTGCTTTTCGAGGCGCTGCCTGTGACTCAGCATGGGAGAAGGGGGCGGAACTGCACACTTTCGTGTTCAGAGCATTGTCCGAGTGAATAG MEDTDQEIEFQLFVVVEPLIKERDAVYESLPGSPARTTRASFPTCGSSVLFEALPVTQHGRRGRNCTLSCSEHCPSE Homology
BLAST of Bhi12G001303 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 47.8 bits (112), Expect = 4.7e-06 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy Swiss-Prot
Match: A6MMT6 (DNA-directed RNA polymerase subunit beta OS=Illicium oligandrum OX=145286 GN=rpoB PE=3 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 2.7e-06 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy Swiss-Prot
Match: A9LYH7 (DNA-directed RNA polymerase subunit beta OS=Acorus americanus OX=263995 GN=rpoB PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.5e-06 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy Swiss-Prot
Match: Q3V542 (DNA-directed RNA polymerase subunit beta OS=Acorus calamus OX=4465 GN=rpoB PE=3 SV=2) HSP 1 Score: 52.0 bits (123), Expect = 3.5e-06 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy Swiss-Prot
Match: Q5QA72 (DNA-directed RNA polymerase subunit beta OS=Acorus gramineus OX=55184 GN=rpoB PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.5e-06 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy Swiss-Prot
Match: Q8S8X9 (DNA-directed RNA polymerase subunit beta OS=Atropa belladonna OX=33113 GN=rpoB PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.5e-06 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. NCBI nr
Match: KAG5606558.1 (hypothetical protein H5410_028050, partial [Solanum commersonii]) HSP 1 Score: 86.3 bits (212), Expect = 1.3e-13 Identity = 39/48 (81.25%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of Bhi12G001303 vs. NCBI nr
Match: KAG5575582.1 (hypothetical protein H5410_055716 [Solanum commersonii]) HSP 1 Score: 84.0 bits (206), Expect = 6.4e-13 Identity = 40/50 (80.00%), Postives = 41/50 (82.00%), Query Frame = 0
BLAST of Bhi12G001303 vs. NCBI nr
Match: YP_009745379.1 (RNA polymerase beta subunit [Primula tsiangii] >QIH29824.1 RNA polymerase beta subunit [Primula tsiangii]) HSP 1 Score: 54.7 bits (130), Expect = 4.1e-04 Identity = 32/46 (69.57%), Postives = 33/46 (71.74%), Query Frame = 0
BLAST of Bhi12G001303 vs. NCBI nr
Match: YP_009262517.1 (RNA polymerase beta subunit [Acioa guianensis] >ANI87175.1 RNA polymerase beta subunit [Acioa guianensis]) HSP 1 Score: 53.5 bits (127), Expect = 9.2e-04 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. NCBI nr
Match: YP_009640514.1 (RNA polymerase beta subunit [Olea perrieri] >QBS53179.1 RNA polymerase beta subunit [Olea perrieri]) HSP 1 Score: 53.5 bits (127), Expect = 9.2e-04 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy TrEMBL
Match: A0A3Q7FG84 (Uncharacterized protein OS=Solanum lycopersicum OX=4081 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 4.6e-17 Identity = 44/48 (91.67%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy TrEMBL
Match: A0A5C0Q119 (DNA-directed RNA polymerase subunit beta OS=Nasa triphylla OX=77620 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 4.5e-04 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy TrEMBL
Match: M4GXN6 (DNA-directed RNA polymerase subunit beta OS=Francoa sonchifolia OX=23250 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 4.5e-04 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy TrEMBL
Match: A0A291EX78 (DNA-directed RNA polymerase subunit beta OS=Sinowilsonia henryi OX=51004 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 4.5e-04 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi12G001303 vs. ExPASy TrEMBL
Match: V9NYU8 (DNA-directed RNA polymerase subunit beta OS=Melianthus villosus OX=377280 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 4.5e-04 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|