![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Bhi11G002418 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGCGGATCAGTTTCGAGTTAATGGATACTCTAAGATAGAACGAGAAAAATTGAATTTGATTAATTCAACTTCTAAAAGTTTGGAACACGACTTGGAGGGAGATATTTCATATCTTTCGAGATCCACCCTACAATATGGGCTTCCAGGTGGTATGAAAGAAAGATTCACACAAGAAAAGTGA ATGGAAGCGGATCAGTTTCGAGTTAATGGATACTCTAAGATAGAACGAGAAAAATTGAATTTGATTAATTCAACTTCTAAAAGTTTGGAACACGACTTGGAGGGAGATATTTCATATCTTTCGAGATCCACCCTACAATATGGGCTTCCAGGTGGTATGAAAGAAAGATTCACACAAGAAAAGTGA ATGGAAGCGGATCAGTTTCGAGTTAATGGATACTCTAAGATAGAACGAGAAAAATTGAATTTGATTAATTCAACTTCTAAAAGTTTGGAACACGACTTGGAGGGAGATATTTCATATCTTTCGAGATCCACCCTACAATATGGGCTTCCAGGTGGTATGAAAGAAAGATTCACACAAGAAAAGTGA MEADQFRVNGYSKIEREKLNLINSTSKSLEHDLEGDISYLSRSTLQYGLPGGMKERFTQEK Homology
BLAST of Bhi11G002418 vs. TAIR 10
Match: ATCG00130.1 (ATPase, F0 complex, subunit B/B', bacterial/chloroplast ) HSP 1 Score: 50.4 bits (119), Expect = 5.8e-07 Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy Swiss-Prot
Match: Q4VZP7 (ATP synthase subunit b, chloroplastic OS=Cucumis sativus OX=3659 GN=atpF PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.3e-08 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy Swiss-Prot
Match: Q09X31 (ATP synthase subunit b, chloroplastic OS=Morus indica OX=248361 GN=atpF PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 1.9e-07 Identity = 27/29 (93.10%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy Swiss-Prot
Match: A6MM22 (ATP synthase subunit b, chloroplastic OS=Buxus microphylla OX=153571 GN=atpF PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 5.6e-07 Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy Swiss-Prot
Match: A0ZZ21 (ATP synthase subunit b, chloroplastic OS=Gossypium barbadense OX=3634 GN=atpF PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 5.6e-07 Identity = 27/30 (90.00%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy Swiss-Prot
Match: Q2L8Z3 (ATP synthase subunit b, chloroplastic OS=Gossypium hirsutum OX=3635 GN=atpF PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 5.6e-07 Identity = 27/30 (90.00%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of Bhi11G002418 vs. NCBI nr
Match: YP_009325975.1 (ATP synthase CF0 B subunit [Citrullus lanatus] >YP_009348017.1 ATP synthase CF0 B subunit [Citrullus mucosospermus] >YP_009420780.1 ATP synthase CF0 B subunit [Citrullus colocynthis] >YP_009431543.1 ATP synthase CF0 B subunit [Citrullus amarus] >YP_009431628.1 ATP synthase CF0 B subunit [Citrullus rehmii] >YP_009456132.1 ATP synthase CF0 B subunit [Lagenaria siceraria] >APW82447.1 ATP synthase CF0 B subunit [Citrullus lanatus subsp. vulgaris] >ASY97461.1 ATP synthase CF0 B subunit [Cucumis sativus var. hardwickii] >QNM38517.1 ATP synthase CF0 subunit I [Lagenaria siceraria var. microcarpa] >APD52466.1 ATP synthase CF0 B subunit [Citrullus lanatus] >APW82532.1 ATP synthase CF0 B subunit [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 58.9 bits (141), Expect = 1.7e-05 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. NCBI nr
Match: AHM91169.1 (ATP synthase CF0 subunit I [Lagenaria siceraria]) HSP 1 Score: 58.9 bits (141), Expect = 1.7e-05 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. NCBI nr
Match: YP_009752990.1 (CF0 subunit I [Gerrardanthus macrorhizus] >QIT06062.1 CF0 subunit I [Gerrardanthus macrorhizus]) HSP 1 Score: 58.9 bits (141), Expect = 1.7e-05 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. NCBI nr
Match: YP_009440143.1 (ATP synthase CF0 B subunit [Gynostemma longipes] >ANI25171.1 ATP synthase CF0 B subunit [Gynostemma pentaphyllum] >ART64986.1 ATP synthase CF0 B subunit [Gynostemma pentaphyllum] >ATG86914.1 ATP synthase CF0 B subunit [Gynostemma longipes]) HSP 1 Score: 58.9 bits (141), Expect = 1.7e-05 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. NCBI nr
Match: YP_009751892.1 (CF0 subunit I [Cyclanthera pedata] >QIT04710.1 CF0 subunit I [Cyclanthera pedata] >QWQ50073.1 ATP synthase CF0 subunit I [Cyclanthera pedata]) HSP 1 Score: 58.9 bits (141), Expect = 1.7e-05 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy TrEMBL
Match: A0A218KG26 (ATP synthase subunit b, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=atpF PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 8.4e-06 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy TrEMBL
Match: A0A1X9Q1S9 (ATP synthase subunit b, chloroplastic OS=Cucumis sativus OX=3659 GN=atpF PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 8.4e-06 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy TrEMBL
Match: A0A249RZG2 (ATP synthase subunit b, chloroplastic OS=Cucumis melo var. cantalupensis OX=3658 GN=atpF PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 8.4e-06 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy TrEMBL
Match: A0A191T450 (ATP synthase subunit b, chloroplastic OS=Gynostemma pentaphyllum OX=182084 GN=atpF PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 8.4e-06 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Bhi11G002418 vs. ExPASy TrEMBL
Match: A0A1P8LDX5 (ATP synthase CF0 B subunit OS=Citrullus mucosospermus OX=519315 GN=atpF PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 8.4e-06 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|