Bhi11G000591 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCTCAAATTTCAAATTCTCCTACTTCAATTATGAAAGCCAATGACATTCCTGATACTAAGCGTTCTATTGCAAATTTTCATCCTAGCATTTGGACTAATCATTTCCTTTCATCTACCTTTGATGATGCATTGGTAAAACTAAATTCCAATACTTTTCTATTTTGAATAATTTTAAATTTTTATTCTTTTAATTTCAGAAAGTAAACGATGGAACGAAAGAACAAGCTAGAAAGTTGAAAGAAGAAATACGGATGATGGTAGTTGTTTTAGTGGAAAACCCATTGGAGAAGCTAACATTGGTTGATTCAATCCAACGACTAG ATGTCTTCTCAAATTTCAAATTCTCCTACTTCAATTATGAAAGCCAATGACATTCCTGATACTAAGCGTTCTATTGCAAATTTTCATCCTAGCATTTGGACTAATCATTTCCTTTCATCTACCTTTGATGATGCATTGAAAGTAAACGATGGAACGAAAGAACAAGCTAGAAAGTTGAAAGAAGAAATACGGATGATGGTAGTTGTTTTAGTGGAAAACCCATTGGAGAAGCTAACATTGGTTGATTCAATCCAACGACTAG ATGTCTTCTCAAATTTCAAATTCTCCTACTTCAATTATGAAAGCCAATGACATTCCTGATACTAAGCGTTCTATTGCAAATTTTCATCCTAGCATTTGGACTAATCATTTCCTTTCATCTACCTTTGATGATGCATTGAAAGTAAACGATGGAACGAAAGAACAAGCTAGAAAGTTGAAAGAAGAAATACGGATGATGGTAGTTGTTTTAGTGGAAAACCCATTGGAGAAGCTAACATTGGTTGATTCAATCCAACGACTAG MSSQISNSPTSIMKANDIPDTKRSIANFHPSIWTNHFLSSTFDDALKVNDGTKEQARKLKEEIRMMVVVLVENPLEKLTLVDSIQRL Homology
BLAST of Bhi11G000591 vs. ExPASy Swiss-Prot
Match: B2KSJ5 ((+)-gamma-cadinene synthase OS=Cucumis melo OX=3656 PE=1 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.3e-28 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy Swiss-Prot
Match: Q6Q3H3 ((-)-germacrene D synthase OS=Vitis vinifera OX=29760 GN=VIT_19s0014g04930 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.5e-08 Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy Swiss-Prot
Match: Q94JS8 ((E)-beta-farnesene synthase OS=Citrus junos OX=135197 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 7.2e-08 Identity = 28/68 (41.18%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy Swiss-Prot
Match: Q5SBP7 (Selinene synthase OS=Ocimum basilicum OX=39350 GN=SES PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.6e-07 Identity = 32/83 (38.55%), Postives = 52/83 (62.65%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy Swiss-Prot
Match: B9S9Z3 (Alpha-copaene synthase OS=Ricinus communis OX=3988 GN=TPS1 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.6e-07 Identity = 32/88 (36.36%), Postives = 52/88 (59.09%), Query Frame = 0
BLAST of Bhi11G000591 vs. NCBI nr
Match: XP_038905757.1 ((+)-gamma-cadinene synthase-like [Benincasa hispida]) HSP 1 Score: 139.4 bits (350), Expect = 1.4e-29 Identity = 71/87 (81.61%), Postives = 78/87 (89.66%), Query Frame = 0
BLAST of Bhi11G000591 vs. NCBI nr
Match: NP_001284382.1 ((+)-gamma-cadinene synthase [Cucumis melo] >B2KSJ5.1 RecName: Full=(+)-gamma-cadinene synthase; Short=CmTpsNY; AltName: Full=(+)-delta-cadinene synthase [Cucumis melo] >ABX83200.1 terpene synthase [Cucumis melo]) HSP 1 Score: 126.7 bits (317), Expect = 9.7e-26 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 0
BLAST of Bhi11G000591 vs. NCBI nr
Match: NP_001315388.1 ((+)-gamma-cadinene synthase-like [Cucumis melo] >AJD19682.1 sesquiterpene synthase Tps1 [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 1.7e-25 Identity = 64/87 (73.56%), Postives = 72/87 (82.76%), Query Frame = 0
BLAST of Bhi11G000591 vs. NCBI nr
Match: XP_038903601.1 ((+)-gamma-cadinene synthase-like [Benincasa hispida]) HSP 1 Score: 124.8 bits (312), Expect = 3.7e-25 Identity = 64/75 (85.33%), Postives = 68/75 (90.67%), Query Frame = 0
BLAST of Bhi11G000591 vs. NCBI nr
Match: NP_001292628.1 ((+)-gamma-cadinene synthase [Cucumis sativus] >AAU05952.1 beta-caryophyllene synthase [Cucumis sativus]) HSP 1 Score: 117.5 bits (293), Expect = 5.9e-23 Identity = 60/82 (73.17%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy TrEMBL
Match: A0A1S4DZR2 ((+)-gamma-cadinene synthase-like OS=Cucumis melo OX=3656 GN=LOC103493390 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 7.2e-27 Identity = 65/87 (74.71%), Postives = 73/87 (83.91%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy TrEMBL
Match: A0A1S2X8Q6 ((+)-gamma-cadinene synthase OS=Cucumis melo OX=3656 GN=TPS PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 4.7e-26 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy TrEMBL
Match: A0A0B4VEV4 (Sesquiterpene synthase Tps1 OS=Cucumis melo OX=3656 PE=2 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 8.0e-26 Identity = 64/87 (73.56%), Postives = 72/87 (82.76%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy TrEMBL
Match: Q66PX8 (Beta-caryophyllene synthase OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 2.8e-23 Identity = 60/82 (73.17%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Bhi11G000591 vs. ExPASy TrEMBL
Match: A0A0A0L579 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G097040 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 2.8e-23 Identity = 60/82 (73.17%), Postives = 67/82 (81.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|