Bhi10G000323 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTAGACACTTCGAACCCGGACCCGACCCTAGACTCAAGGTATGCGGATCAACTACGGCAAAGTTTTCAACCAGCGCGAGACACATTTGTGAATCTGGGCCCGAGACGCCAAACACGTTTGACAGAAATTACTTCACAAATTTGCAGAACAACCAAGGGCTTTTAGGAAGTGACCAAGTTCCGTTCTCTACTAGCGGAGCTCCAACTATCAGTATTGTCAACAATTTCCCCAATAGTGAGAGTGTGTTCTTCAATGCCTTCATTCAGTCTATGATTAATAAGGGAAATCTCGACCATTTGATTGGGAGCGGTGGAGAAATCAGAAACAATTGTACAAGGCTCAATTAA ATGACTAGACACTTCGAACCCGGACCCGACCCTAGACTCAAGGTATGCGGATCAACTACGGCAAAGTTTTCAACCAGCGCGAGACACATTTGTGAATCTGGGCCCGAGACGCCAAACACGTTTGACAGAAATTACTTCACAAATTTGCAGAACAACCAAGGGCTTTTAGGAAGTGACCAAGTTCCGTTCTCTACTAGCGGAGCTCCAACTATCAGTATTGTCAACAATTTCCCCAATAGTGAGAGTGTGTTCTTCAATGCCTTCATTCAGTCTATGATTAATAAGGGAAATCTCGACCATTTGATTGGGAGCGGTGGAGAAATCAGAAACAATTGTACAAGGCTCAATTAA ATGACTAGACACTTCGAACCCGGACCCGACCCTAGACTCAAGGTATGCGGATCAACTACGGCAAAGTTTTCAACCAGCGCGAGACACATTTGTGAATCTGGGCCCGAGACGCCAAACACGTTTGACAGAAATTACTTCACAAATTTGCAGAACAACCAAGGGCTTTTAGGAAGTGACCAAGTTCCGTTCTCTACTAGCGGAGCTCCAACTATCAGTATTGTCAACAATTTCCCCAATAGTGAGAGTGTGTTCTTCAATGCCTTCATTCAGTCTATGATTAATAAGGGAAATCTCGACCATTTGATTGGGAGCGGTGGAGAAATCAGAAACAATTGTACAAGGCTCAATTAA MTRHFEPGPDPRLKVCGSTTAKFSTSARHICESGPETPNTFDRNYFTNLQNNQGLLGSDQVPFSTSGAPTISIVNNFPNSESVFFNAFIQSMINKGNLDHLIGSGGEIRNNCTRLN Homology
BLAST of Bhi10G000323 vs. TAIR 10
Match: AT5G06720.1 (peroxidase 2 ) HSP 1 Score: 98.2 bits (243), Expect = 4.6e-21 Identity = 54/112 (48.21%), Postives = 72/112 (64.29%), Query Frame = 0
BLAST of Bhi10G000323 vs. TAIR 10
Match: AT5G06730.1 (Peroxidase superfamily protein ) HSP 1 Score: 96.3 bits (238), Expect = 1.7e-20 Identity = 45/80 (56.25%), Postives = 60/80 (75.00%), Query Frame = 0
BLAST of Bhi10G000323 vs. TAIR 10
Match: AT5G19880.1 (Peroxidase superfamily protein ) HSP 1 Score: 92.8 bits (229), Expect = 1.9e-19 Identity = 42/82 (51.22%), Postives = 61/82 (74.39%), Query Frame = 0
BLAST of Bhi10G000323 vs. TAIR 10
Match: AT2G38390.1 (Peroxidase superfamily protein ) HSP 1 Score: 91.7 bits (226), Expect = 4.3e-19 Identity = 45/80 (56.25%), Postives = 56/80 (70.00%), Query Frame = 0
BLAST of Bhi10G000323 vs. TAIR 10
Match: AT2G38380.1 (Peroxidase superfamily protein ) HSP 1 Score: 88.2 bits (217), Expect = 4.7e-18 Identity = 44/80 (55.00%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy Swiss-Prot
Match: Q9LEH3 (Peroxidase 15 OS=Ipomoea batatas OX=4120 GN=pod PE=1 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 6.7e-25 Identity = 63/118 (53.39%), Postives = 78/118 (66.10%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy Swiss-Prot
Match: P19135 (Peroxidase 2 (Fragment) OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 7.6e-21 Identity = 57/118 (48.31%), Postives = 71/118 (60.17%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy Swiss-Prot
Match: Q42578 (Peroxidase 53 OS=Arabidopsis thaliana OX=3702 GN=PER53 PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.4e-20 Identity = 54/112 (48.21%), Postives = 72/112 (64.29%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy Swiss-Prot
Match: Q9FG34 (Peroxidase 54 OS=Arabidopsis thaliana OX=3702 GN=PER54 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.4e-19 Identity = 45/80 (56.25%), Postives = 60/80 (75.00%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy Swiss-Prot
Match: P80679 (Peroxidase A2 OS=Armoracia rusticana OX=3704 GN=HRPA2 PE=1 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.2e-19 Identity = 52/113 (46.02%), Postives = 72/113 (63.72%), Query Frame = 0
BLAST of Bhi10G000323 vs. NCBI nr
Match: XP_038900323.1 (peroxidase 2-like [Benincasa hispida]) HSP 1 Score: 131.0 bits (328), Expect = 6.8e-27 Identity = 71/116 (61.21%), Postives = 80/116 (68.97%), Query Frame = 0
BLAST of Bhi10G000323 vs. NCBI nr
Match: XP_023532776.1 (peroxidase 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 127.5 bits (319), Expect = 7.6e-26 Identity = 69/116 (59.48%), Postives = 78/116 (67.24%), Query Frame = 0
BLAST of Bhi10G000323 vs. NCBI nr
Match: XP_022995229.1 (peroxidase 2-like [Cucurbita maxima]) HSP 1 Score: 127.5 bits (319), Expect = 7.6e-26 Identity = 69/116 (59.48%), Postives = 78/116 (67.24%), Query Frame = 0
BLAST of Bhi10G000323 vs. NCBI nr
Match: XP_022933318.1 (peroxidase 2-like isoform X1 [Cucurbita moschata] >XP_022933319.1 peroxidase 2-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 127.5 bits (319), Expect = 7.6e-26 Identity = 69/116 (59.48%), Postives = 78/116 (67.24%), Query Frame = 0
BLAST of Bhi10G000323 vs. NCBI nr
Match: KAG7035829.1 (hypothetical protein SDJN02_02628, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 127.5 bits (319), Expect = 7.6e-26 Identity = 69/116 (59.48%), Postives = 78/116 (67.24%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy TrEMBL
Match: A0A6J1EZF4 (Peroxidase OS=Cucurbita moschata OX=3662 GN=LOC111440536 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.7e-26 Identity = 69/116 (59.48%), Postives = 78/116 (67.24%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy TrEMBL
Match: A0A6J1K546 (Peroxidase OS=Cucurbita maxima OX=3661 GN=LOC111490837 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.7e-26 Identity = 69/116 (59.48%), Postives = 78/116 (67.24%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy TrEMBL
Match: A0A6J1H2P5 (Peroxidase OS=Cucurbita moschata OX=3662 GN=LOC111459154 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.7e-26 Identity = 69/116 (59.48%), Postives = 78/116 (67.24%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy TrEMBL
Match: A0A6J1DHP4 (Peroxidase OS=Momordica charantia OX=3673 GN=LOC111021188 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 4.8e-26 Identity = 68/116 (58.62%), Postives = 80/116 (68.97%), Query Frame = 0
BLAST of Bhi10G000323 vs. ExPASy TrEMBL
Match: A0A6J1JCZ4 (Peroxidase OS=Cucurbita maxima OX=3661 GN=LOC111483916 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 1.4e-25 Identity = 69/116 (59.48%), Postives = 79/116 (68.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|