
Bhi09G000261 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATAGTAGTTTTTTCTTTCTTTTTTTCTCTTTTGAAAAAACATATTTTATCTTTATATATATTTTATACTATATCCAAAGTTCGAAATATCGATGTCAATGAAAATATCGAGGTCCTGATTTTGTGGAAAGAATCGTTGGTGAAAAACATTATGAAACTGCGCAAAGAGTTAAACAAACCTTACAACGTTACAAAGAACTGCAGGACATTATAGCTATCCTTGGGTTGGACGAATTATCCGAAGAGGATCGCTTAACCGTAGCACGAGCACGCAAAATTGAGCGTTTCTTATCACAACCTTTTTTCGTAGCAGAAGTATTTACTGGTTCCCCCGGGAAATACGTTGGCCTAGCAGAAACAATTAGAGGGCTCTCGCGTGTCCGGGGTCCGATCAGATCAACCAGCGACTGGTTTACAGAACAAGGAGTTAAGCAAGGGCCAGGAGATTGA ATGATAGACATTATAGCTATCCTTGGGTTGGACGAATTATCCGAAGAGGATCGCTTAACCGTAGCACGAGCACGCAAAATTGAGCGTTTCTTATCACAACCTTTTTTCGTAGCAGAAGTATTTACTGGTTCCCCCGGGAAATACGTTGGCCTAGCAGAAACAATTAGAGGGCTCTCGCGTGTCCGGGGTCCGATCAGATCAACCAGCGACTGGTTTACAGAACAAGGAGTTAAGCAAGGGCCAGGAGATTGA ATGATAGACATTATAGCTATCCTTGGGTTGGACGAATTATCCGAAGAGGATCGCTTAACCGTAGCACGAGCACGCAAAATTGAGCGTTTCTTATCACAACCTTTTTTCGTAGCAGAAGTATTTACTGGTTCCCCCGGGAAATACGTTGGCCTAGCAGAAACAATTAGAGGGCTCTCGCGTGTCCGGGGTCCGATCAGATCAACCAGCGACTGGTTTACAGAACAAGGAGTTAAGCAAGGGCCAGGAGATTGA MIDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGLSRVRGPIRSTSDWFTEQGVKQGPGD Homology
BLAST of Bhi09G000261 vs. TAIR 10
Match: ATCG00480.1 (ATP synthase subunit beta ) HSP 1 Score: 109.8 bits (273), Expect = 1.1e-24 Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 0
BLAST of Bhi09G000261 vs. TAIR 10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 89.7 bits (221), Expect = 1.2e-18 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of Bhi09G000261 vs. TAIR 10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 89.7 bits (221), Expect = 1.2e-18 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of Bhi09G000261 vs. TAIR 10
Match: AT5G08690.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 89.7 bits (221), Expect = 1.2e-18 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy Swiss-Prot
Match: Q9MRR9 (ATP synthase subunit beta, chloroplastic OS=Brasenia schreberi OX=4424 GN=atpB PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 5.3e-24 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy Swiss-Prot
Match: Q8MBF7 (ATP synthase subunit beta, chloroplastic OS=Montinia caryophyllacea OX=23084 GN=atpB PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 5.3e-24 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy Swiss-Prot
Match: Q6EW72 (ATP synthase subunit beta, chloroplastic OS=Nymphaea alba OX=34301 GN=atpB PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 5.3e-24 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy Swiss-Prot
Match: Q9MU26 (ATP synthase subunit beta, chloroplastic OS=Nymphaea odorata OX=4419 GN=atpB PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 5.3e-24 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy Swiss-Prot
Match: P19366 (ATP synthase subunit beta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpB PE=1 SV=2) HSP 1 Score: 109.8 bits (273), Expect = 1.5e-23 Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy TrEMBL
Match: Q8MBJ5 (ATP synthase subunit beta (Fragment) OS=Petrogenia repens OX=197430 GN=atpB PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.5e-21 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy TrEMBL
Match: A0A6H1XKW4 (ATP synthase subunit beta, chloroplastic OS=Euonymus szechuanensis OX=2726726 GN=atpB PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.5e-21 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy TrEMBL
Match: A0A2H4NVN8 (ATP synthase subunit beta, chloroplastic OS=Lecythis minor OX=372754 GN=atpB PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.5e-21 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy TrEMBL
Match: A0A290Y309 (ATP synthase subunit beta, chloroplastic OS=Euonymus schensianus OX=2039006 GN=atpB PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.5e-21 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Bhi09G000261 vs. ExPASy TrEMBL
Match: A0A1C9HC61 (ATP synthase subunit beta (Fragment) OS=Glyptopetalum sp. TY-2016 OX=1898797 GN=atpB PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.5e-21 Identity = 59/73 (80.82%), Postives = 61/73 (83.56%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|