Bhi06G000243 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTCCGGCCACCACCACCGCCTCTGGAATACACCGATGCCTTATCTCTTCGGCGGAATAGCCTTATTTCTGTTTCTTATCCTCACCGCATTGATTTTACTCGCTTGTTCCCACCGGAAACGCTCTTCCTCTTCATCTTCTTCCGACGAAGAACATCAGAGCACGAAGATCGATACGCCTGCAGCAAAAACCGCCGCCGTCATCATGGCCGGAAATCACACGCCGACGTTCCTCGCTACCACTACTACTACGCCGACTTAA ATGAATTCCGGCCACCACCACCGCCTCTGGAATACACCGATGCCTTATCTCTTCGGCGGAATAGCCTTATTTCTGTTTCTTATCCTCACCGCATTGATTTTACTCGCTTGTTCCCACCGGAAACGCTCTTCCTCTTCATCTTCTTCCGACGAAGAACATCAGAGCACGAAGATCGATACGCCTGCAGCAAAAACCGCCGCCGTCATCATGGCCGGAAATCACACGCCGACGTTCCTCGCTACCACTACTACTACGCCGACTTAA ATGAATTCCGGCCACCACCACCGCCTCTGGAATACACCGATGCCTTATCTCTTCGGCGGAATAGCCTTATTTCTGTTTCTTATCCTCACCGCATTGATTTTACTCGCTTGTTCCCACCGGAAACGCTCTTCCTCTTCATCTTCTTCCGACGAAGAACATCAGAGCACGAAGATCGATACGCCTGCAGCAAAAACCGCCGCCGTCATCATGGCCGGAAATCACACGCCGACGTTCCTCGCTACCACTACTACTACGCCGACTTAA MNSGHHHRLWNTPMPYLFGGIALFLFLILTALILLACSHRKRSSSSSSSDEEHQSTKIDTPAAKTAAVIMAGNHTPTFLATTTTTPT Homology
BLAST of Bhi06G000243 vs. TAIR 10
Match: AT5G24920.1 (glutamine dumper 5 ) HSP 1 Score: 58.2 bits (139), Expect = 3.9e-09 Identity = 38/76 (50.00%), Postives = 47/76 (61.84%), Query Frame = 0
BLAST of Bhi06G000243 vs. TAIR 10
Match: AT4G25760.1 (glutamine dumper 2 ) HSP 1 Score: 56.2 bits (134), Expect = 1.5e-08 Identity = 37/86 (43.02%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Bhi06G000243 vs. TAIR 10
Match: AT2G24762.1 (glutamine dumper 4 ) HSP 1 Score: 55.1 bits (131), Expect = 3.3e-08 Identity = 36/80 (45.00%), Postives = 49/80 (61.25%), Query Frame = 0
BLAST of Bhi06G000243 vs. TAIR 10
Match: AT5G57685.1 (glutamine dumper 3 ) HSP 1 Score: 55.1 bits (131), Expect = 3.3e-08 Identity = 40/91 (43.96%), Postives = 50/91 (54.95%), Query Frame = 0
BLAST of Bhi06G000243 vs. TAIR 10
Match: AT4G31730.1 (glutamine dumper 1 ) HSP 1 Score: 53.1 bits (126), Expect = 1.3e-07 Identity = 39/92 (42.39%), Postives = 52/92 (56.52%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy Swiss-Prot
Match: Q3E965 (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana OX=3702 GN=GDU5 PE=2 SV=2) HSP 1 Score: 58.2 bits (139), Expect = 5.5e-08 Identity = 38/76 (50.00%), Postives = 47/76 (61.84%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy Swiss-Prot
Match: Q9SW07 (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana OX=3702 GN=GDU2 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.1e-07 Identity = 37/86 (43.02%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy Swiss-Prot
Match: Q9FHH5 (Protein GLUTAMINE DUMPER 3 OS=Arabidopsis thaliana OX=3702 GN=GDU3 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.7e-07 Identity = 40/91 (43.96%), Postives = 50/91 (54.95%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy Swiss-Prot
Match: Q8S8A0 (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana OX=3702 GN=GDU4 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.7e-07 Identity = 36/80 (45.00%), Postives = 49/80 (61.25%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy Swiss-Prot
Match: O81775 (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana OX=3702 GN=GDU1 PE=1 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.8e-06 Identity = 39/92 (42.39%), Postives = 52/92 (56.52%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy TrEMBL
Match: A0A5D3BQQ1 (Protein GLUTAMINE DUMPER 6-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold169G002130 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 2.9e-20 Identity = 65/96 (67.71%), Postives = 74/96 (77.08%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy TrEMBL
Match: A0A6A4PUC1 (Uncharacterized protein OS=Lupinus albus OX=3870 GN=Lal_00036744 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 4.0e-09 Identity = 42/85 (49.41%), Postives = 56/85 (65.88%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy TrEMBL
Match: A0A1S3TUR8 (protein GLUTAMINE DUMPER 6 OS=Vigna radiata var. radiata OX=3916 GN=LOC106759023 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 6.8e-09 Identity = 42/87 (48.28%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy TrEMBL
Match: A0A498J2N3 (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_032097 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 6.8e-09 Identity = 42/83 (50.60%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Bhi06G000243 vs. ExPASy TrEMBL
Match: A0A0B2Q391 (Protein GLUTAMINE DUMPER 1 OS=Glycine soja OX=3848 GN=D0Y65_021597 PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 1.2e-08 Identity = 41/92 (44.57%), Postives = 55/92 (59.78%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|