Bhi03G002088 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTAAATATTCTCGCATTTATTGCTACTGCACTGTTCATTCTACTTCTTACCACCGAACAAGCCTTTTATTTGGTAGGTAACATTGATGAAGCTACTGCGAAGGCTACGAACTTAGAAATGGAGAGCAAATTGATTGAAGAAATGACCTTAAATCTTAGTGTCCTGACTCCGAATCGAATTATTTGGGATTCAGAAGTGAAAGAAATCATTTTAGTTACGAATAGTGGACAAATTGGGTTCAATGCAATCATCTGA ATGGAAGTAAATATTCTCGCATTTATTGCTACTGCACTGTTCATTCTACTTCTTACCACCGAACAAGCCTTTTATTTGGTAGGTAACATTGATGAAGCTACTGCGAAGGCTACGAACTTAGAAATGGAGAGCAAATTGATTGAAGAAATGACCTTAAATCTTAGTGTCCTGACTCCGAATCGAATTATTTGGGATTCAGAAGTGAAAGAAATCATTTTAGTTACGAATAGTGGACAAATTGGGTTCAATGCAATCATCTGA ATGGAAGTAAATATTCTCGCATTTATTGCTACTGCACTGTTCATTCTACTTCTTACCACCGAACAAGCCTTTTATTTGGTAGGTAACATTGATGAAGCTACTGCGAAGGCTACGAACTTAGAAATGGAGAGCAAATTGATTGAAGAAATGACCTTAAATCTTAGTGTCCTGACTCCGAATCGAATTATTTGGGATTCAGAAGTGAAAGAAATCATTTTAGTTACGAATAGTGGACAAATTGGGTTCAATGCAATCATCTGA MEVNILAFIATALFILLLTTEQAFYLVGNIDEATAKATNLEMESKLIEEMTLNLSVLTPNRIIWDSEVKEIILVTNSGQIGFNAII Homology
BLAST of Bhi03G002088 vs. TAIR 10
Match: ATCG00470.1 (ATP synthase epsilon chain ) HSP 1 Score: 60.8 bits (146), Expect = 6.0e-10 Identity = 29/32 (90.62%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi03G002088 vs. TAIR 10
Match: ATCG00480.1 (ATP synthase subunit beta ) HSP 1 Score: 53.5 bits (127), Expect = 9.6e-08 Identity = 26/26 (100.00%), Postives = 26/26 (100.00%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy Swiss-Prot
Match: Q4VZG9 (ATP synthase epsilon chain, chloroplastic OS=Cucumis sativus OX=3659 GN=atpE PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-10 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy Swiss-Prot
Match: Q70XZ7 (ATP synthase epsilon chain, chloroplastic OS=Amborella trichopoda OX=13333 GN=atpE PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.5e-09 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy Swiss-Prot
Match: Q7YJW6 (ATP synthase epsilon chain, chloroplastic OS=Calycanthus floridus var. glaucus OX=212734 GN=atpE PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.5e-09 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy Swiss-Prot
Match: Q06GZ1 (ATP synthase epsilon chain, chloroplastic OS=Drimys granadensis OX=224735 GN=atpE PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.5e-09 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy Swiss-Prot
Match: Q0G9L3 (ATP synthase epsilon chain, chloroplastic OS=Liriodendron tulipifera OX=3415 GN=atpE PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.5e-09 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of Bhi03G002088 vs. NCBI nr
Match: VVW89794.1 (unnamed protein product, partial [Nymphaea colorata]) HSP 1 Score: 92.8 bits (229), Expect = 1.5e-15 Identity = 50/59 (84.75%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of Bhi03G002088 vs. NCBI nr
Match: RDY14683.1 (ATP synthase subunit beta, chloroplastic, partial [Mucuna pruriens]) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-09 Identity = 43/61 (70.49%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of Bhi03G002088 vs. NCBI nr
Match: KAF1876833.1 (hypothetical protein Lal_00033121 [Lupinus albus]) HSP 1 Score: 70.9 bits (172), Expect = 6.2e-09 Identity = 41/62 (66.13%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi03G002088 vs. NCBI nr
Match: KAF4381351.1 (hypothetical protein F8388_026450, partial [Cannabis sativa]) HSP 1 Score: 70.5 bits (171), Expect = 8.1e-09 Identity = 41/62 (66.13%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi03G002088 vs. NCBI nr
Match: KAF4394665.1 (hypothetical protein G4B88_011126, partial [Cannabis sativa]) HSP 1 Score: 70.5 bits (171), Expect = 8.1e-09 Identity = 41/62 (66.13%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy TrEMBL
Match: A0A5K1HX57 (ATP-synt_DE_N domain-containing protein (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS30491 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 7.4e-16 Identity = 50/59 (84.75%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy TrEMBL
Match: A0A371II26 (NADH dehydrogenase subunit 3 (Fragment) OS=Mucuna pruriens OX=157652 GN=atpB PE=3 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 1.4e-09 Identity = 43/61 (70.49%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy TrEMBL
Match: A0A6A5MZ22 (H(+)-transporting two-sector ATPase OS=Lupinus albus OX=3870 GN=Lal_00033121 PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 3.0e-09 Identity = 41/62 (66.13%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy TrEMBL
Match: A0A7J6GEG5 (H(+)-transporting two-sector ATPase (Fragment) OS=Cannabis sativa OX=3483 GN=F8388_026450 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 3.9e-09 Identity = 41/62 (66.13%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi03G002088 vs. ExPASy TrEMBL
Match: A0A7J6HHZ8 (H(+)-transporting two-sector ATPase OS=Cannabis sativa OX=3483 GN=G4B88_011126 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 3.9e-09 Identity = 41/62 (66.13%), Postives = 45/62 (72.58%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|