![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Bhi03G000923 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCAAATCTGCCCTTTTCCTCTCCATTCTCCTTTCATTCTCTGCTATAGCTTTCTCCGATGTATTTCCACTAACTCTGTTTTTTTCCTCTGATTTCGTATCTTGATTCTTGAGTGAGGAAAGAAAAAAATTGACTGATACAGATTTTGGATTTGGTTGATGCAGGATCCAGATTGCGTGTACACGGTGTATATCAGAACAGGGTCGATCCTGAAAGCAGGGACGGACTCGGTTATTACGGCCACGCTCTACACGGCGCAAGGGAAGAGATACCGGGTTGATGGGACCCAATACAACTACTTCGAGAGGGGCAATCTGGACATTTTTCAAGCGGAAGAGGGACCATGCTCTGAGCGACCGGTGTGTTCATTGAACTGA ATGGCTTCCAAATCTGCCCTTTTCCTCTCCATTCTCCTTTCATTCTCTGCTATAGCTTTCTCCGATGATCCAGATTGCGTGTACACGGTGTATATCAGAACAGGGTCGATCCTGAAAGCAGGGACGGACTCGGTTATTACGGCCACGCTCTACACGGCGCAAGGGAAGAGATACCGGGTTGATGGGACCCAATACAACTACTTCGAGAGGGGCAATCTGGACATTTTTCAAGCGGAAGAGGGACCATGCTCTGAGCGACCGGTGTGTTCATTGAACTGA ATGGCTTCCAAATCTGCCCTTTTCCTCTCCATTCTCCTTTCATTCTCTGCTATAGCTTTCTCCGATGATCCAGATTGCGTGTACACGGTGTATATCAGAACAGGGTCGATCCTGAAAGCAGGGACGGACTCGGTTATTACGGCCACGCTCTACACGGCGCAAGGGAAGAGATACCGGGTTGATGGGACCCAATACAACTACTTCGAGAGGGGCAATCTGGACATTTTTCAAGCGGAAGAGGGACCATGCTCTGAGCGACCGGTGTGTTCATTGAACTGA MASKSALFLSILLSFSAIAFSDDPDCVYTVYIRTGSILKAGTDSVITATLYTAQGKRYRVDGTQYNYFERGNLDIFQAEEGPCSERPVCSLN Homology
BLAST of Bhi03G000923 vs. TAIR 10
Match: AT4G39730.1 (Lipase/lipooxygenase, PLAT/LH2 family protein ) HSP 1 Score: 94.0 bits (232), Expect = 6.8e-20 Identity = 53/104 (50.96%), Postives = 65/104 (62.50%), Query Frame = 0
BLAST of Bhi03G000923 vs. TAIR 10
Match: AT2G22170.1 (Lipase/lipooxygenase, PLAT/LH2 family protein ) HSP 1 Score: 86.7 bits (213), Expect = 1.1e-17 Identity = 51/105 (48.57%), Postives = 64/105 (60.95%), Query Frame = 0
BLAST of Bhi03G000923 vs. ExPASy Swiss-Prot
Match: O65660 (PLAT domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PLAT1 PE=1 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 9.6e-19 Identity = 53/104 (50.96%), Postives = 65/104 (62.50%), Query Frame = 0
BLAST of Bhi03G000923 vs. ExPASy Swiss-Prot
Match: Q9SIE7 (PLAT domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=PLAT2 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.5e-16 Identity = 51/105 (48.57%), Postives = 64/105 (60.95%), Query Frame = 0
BLAST of Bhi03G000923 vs. NCBI nr
Match: XP_004143473.2 (PLAT domain-containing protein 1 [Cucumis sativus] >KGN48760.1 hypothetical protein Csa_003522 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 4.9e-28 Identity = 74/101 (73.27%), Postives = 77/101 (76.24%), Query Frame = 0
BLAST of Bhi03G000923 vs. NCBI nr
Match: XP_008440608.1 (PREDICTED: lipoxygenase homology domain-containing protein 1 [Cucumis melo] >KAA0036292.1 lipoxygenase-like proteiny domain-containing protein 1 [Cucumis melo var. makuwa] >TYK12686.1 lipoxygenase-like proteiny domain-containing protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 132.9 bits (333), Expect = 1.4e-27 Identity = 72/101 (71.29%), Postives = 75/101 (74.26%), Query Frame = 0
BLAST of Bhi03G000923 vs. NCBI nr
Match: XP_004143474.1 (PLAT domain-containing protein 1 [Cucumis sativus] >KGN48761.1 hypothetical protein Csa_004285 [Cucumis sativus]) HSP 1 Score: 129.0 bits (323), Expect = 2.1e-26 Identity = 71/101 (70.30%), Postives = 73/101 (72.28%), Query Frame = 0
BLAST of Bhi03G000923 vs. NCBI nr
Match: XP_008440610.1 (PREDICTED: lipoxygenase homology domain-containing protein 1-like [Cucumis melo]) HSP 1 Score: 127.5 bits (319), Expect = 6.0e-26 Identity = 70/101 (69.31%), Postives = 72/101 (71.29%), Query Frame = 0
BLAST of Bhi03G000923 vs. NCBI nr
Match: XP_038883182.1 (PLAT domain-containing protein 3 [Benincasa hispida]) HSP 1 Score: 124.8 bits (312), Expect = 3.9e-25 Identity = 68/101 (67.33%), Postives = 72/101 (71.29%), Query Frame = 0
BLAST of Bhi03G000923 vs. ExPASy TrEMBL
Match: A0A0A0KGA0 (PLAT domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G500520 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.4e-28 Identity = 74/101 (73.27%), Postives = 77/101 (76.24%), Query Frame = 0
BLAST of Bhi03G000923 vs. ExPASy TrEMBL
Match: A0A5A7SYJ2 (Lipoxygenase-like proteiny domain-containing protein 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G002740 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 6.9e-28 Identity = 72/101 (71.29%), Postives = 75/101 (74.26%), Query Frame = 0
BLAST of Bhi03G000923 vs. ExPASy TrEMBL
Match: A0A1S3B1J7 (lipoxygenase homology domain-containing protein 1 OS=Cucumis melo OX=3656 GN=LOC103484981 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 6.9e-28 Identity = 72/101 (71.29%), Postives = 75/101 (74.26%), Query Frame = 0
BLAST of Bhi03G000923 vs. ExPASy TrEMBL
Match: A0A0A0KLY3 (PLAT domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G500530 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 1.0e-26 Identity = 71/101 (70.30%), Postives = 73/101 (72.28%), Query Frame = 0
BLAST of Bhi03G000923 vs. ExPASy TrEMBL
Match: A0A1S3B1I1 (lipoxygenase homology domain-containing protein 1-like OS=Cucumis melo OX=3656 GN=LOC107990289 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.9e-26 Identity = 70/101 (69.31%), Postives = 72/101 (71.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|