![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Bhi03G000509 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCCATCAACCTGCTAGTTCTTTTTATGAGGCACAAACGAGAGAATTTATCCTAGCAGCAAAAGAACTACTGAAGCTGCGTGAAACCATCACTAGGGTTTATGTACAAAGAATAGCAAACCCTTATGGGTTGTATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGGAATTGTTGATCTTGTAG ATGATCCATCAACCTGCTAGTTCTTTTTATGAGGCACAAACGAGAGAATTTATCCTAGCAGCAAAAGAACTACTGAAGCTGCGTGAAACCATCACTAGGGTTTATGTACAAAGAATAGCAAACCCTTATGGGTTGTATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGGAATTGTTGATCTTGTAG ATGATCCATCAACCTGCTAGTTCTTTTTATGAGGCACAAACGAGAGAATTTATCCTAGCAGCAAAAGAACTACTGAAGCTGCGTGAAACCATCACTAGGGTTTATGTACAAAGAATAGCAAACCCTTATGGGTTGTATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGGAATTGTTGATCTTGTAG MIHQPASSFYEAQTREFILAAKELLKLRETITRVYVQRIANPYGLYPKTWKGMFLCQQQKPKLMELLIL Homology
BLAST of Bhi03G000509 vs. TAIR 10
Match: ATCG00670.1 (plastid-encoded CLP P ) HSP 1 Score: 72.0 bits (175), Expect = 2.1e-13 Identity = 36/42 (85.71%), Postives = 37/42 (88.10%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy Swiss-Prot
Match: A6MM61 (ATP-dependent Clp protease proteolytic subunit OS=Buxus microphylla OX=153571 GN=clpP PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 7.7e-13 Identity = 36/42 (85.71%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy Swiss-Prot
Match: Q09G21 (ATP-dependent Clp protease proteolytic subunit OS=Platanus occidentalis OX=4403 GN=clpP PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.0e-12 Identity = 36/42 (85.71%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy Swiss-Prot
Match: Q09FT6 (ATP-dependent Clp protease proteolytic subunit OS=Nandina domestica OX=41776 GN=clpP PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-12 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy Swiss-Prot
Match: A1XGR3 (ATP-dependent Clp protease proteolytic subunit OS=Ranunculus macranthus OX=334596 GN=clpP PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-12 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy Swiss-Prot
Match: A6MMW9 (ATP-dependent Clp protease proteolytic subunit OS=Illicium oligandrum OX=145286 GN=clpP PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.7e-12 Identity = 36/42 (85.71%), Postives = 37/42 (88.10%), Query Frame = 0
BLAST of Bhi03G000509 vs. NCBI nr
Match: KRG99245.1 (hypothetical protein GLYMA_18G132600v4 [Glycine max]) HSP 1 Score: 116.7 bits (291), Expect = 7.9e-23 Identity = 56/66 (84.85%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of Bhi03G000509 vs. NCBI nr
Match: KAG6736879.1 (hypothetical protein POTOM_060190 [Populus tomentosa]) HSP 1 Score: 108.2 bits (269), Expect = 2.8e-20 Identity = 53/71 (74.65%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of Bhi03G000509 vs. NCBI nr
Match: VDD24611.1 (unnamed protein product, partial [Brassica rapa]) HSP 1 Score: 99.0 bits (245), Expect = 1.7e-17 Identity = 55/72 (76.39%), Postives = 58/72 (80.56%), Query Frame = 0
BLAST of Bhi03G000509 vs. NCBI nr
Match: TYG40841.1 (hypothetical protein ES288_D12G126000v1 [Gossypium darwinii]) HSP 1 Score: 88.6 bits (218), Expect = 2.3e-14 Identity = 48/68 (70.59%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of Bhi03G000509 vs. NCBI nr
Match: VDD65251.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-14 Identity = 48/69 (69.57%), Postives = 52/69 (75.36%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy TrEMBL
Match: K7MRU4 (Uncharacterized protein OS=Glycine max OX=3847 GN=GLYMA_18G132600 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.8e-23 Identity = 56/66 (84.85%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy TrEMBL
Match: A0A3P6DM77 (Uncharacterized protein (Fragment) OS=Brassica campestris OX=3711 GN=BRASC58T46495Z PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 8.3e-18 Identity = 55/72 (76.39%), Postives = 58/72 (80.56%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy TrEMBL
Match: A0A6N2N221 (Uncharacterized protein OS=Salix viminalis OX=40686 GN=SVIM_LOCUS430238 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 1.3e-15 Identity = 44/57 (77.19%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy TrEMBL
Match: A0A5D2A7L5 (Uncharacterized protein OS=Gossypium darwinii OX=34276 GN=ES288_D12G126000v1 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 1.1e-14 Identity = 48/68 (70.59%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of Bhi03G000509 vs. ExPASy TrEMBL
Match: A0A3P6H1B9 (ATP-dependent Clp protease proteolytic subunit OS=Brassica oleracea OX=3712 GN=BOLSC29T60479H PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.5e-14 Identity = 48/69 (69.57%), Postives = 52/69 (75.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|