Cp4.1LG01g13370 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTTCTTCTTCTTCTTCTTCTTCTTTGTCCGCCATTTTCGTTCTCCTTCTCCTTCTTCTTTCTGGGTTTTGCTCTGCAACTCGGCCTGGTAAAACCATGGAACATGAGTTGAAACCCGACTTGTCGAATTTCAATTACAAGACGGGGTTTCGATATGTCGGTCAGACCTTCAGTTATCTTCCCAGAGGCGTCCCGATTCCTCCGTCAGGCCCTTCCGACCGCCACAACTCTCTGGTTGACTCTCTTCCTCCCAGTTAA ATGCTTTCTTCTTCTTCTTCTTCTTCTTTGTCCGCCATTTTCGTTCTCCTTCTCCTTCTTCTTTCTGGGTTTTGCTCTGCAACTCGGCCTGGTAAAACCATGGAACATGAGTTGAAACCCGACTTGTCGAATTTCAATTACAAGACGGGGTTTCGATATGTCGGTCAGACCTTCAGTTATCTTCCCAGAGGCGTCCCGATTCCTCCGTCAGGCCCTTCCGACCGCCACAACTCTCTGGTTGACTCTCTTCCTCCCAGTTAA ATGCTTTCTTCTTCTTCTTCTTCTTCTTTGTCCGCCATTTTCGTTCTCCTTCTCCTTCTTCTTTCTGGGTTTTGCTCTGCAACTCGGCCTGGTAAAACCATGGAACATGAGTTGAAACCCGACTTGTCGAATTTCAATTACAAGACGGGGTTTCGATATGTCGGTCAGACCTTCAGTTATCTTCCCAGAGGCGTCCCGATTCCTCCGTCAGGCCCTTCCGACCGCCACAACTCTCTGGTTGACTCTCTTCCTCCCAGTTAA MLSSSSSSSLSAIFVLLLLLLSGFCSATRPGKTMEHELKPDLSNFNYKTGFRYVGQTFSYLPRGVPIPPSGPSDRHNSLVDSLPPS
BLAST of Cp4.1LG01g13370 vs. Swiss-Prot
Match: IDA_ARATH (Protein IDA OS=Arabidopsis thaliana GN=IDA PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 8.2e-09 Identity = 34/71 (47.89%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. TrEMBL
Match: A0A0A0KR07_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G608230 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.4e-23 Identity = 64/88 (72.73%), Postives = 74/88 (84.09%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. TrEMBL
Match: M5XH24_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa017234mg PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-11 Identity = 40/79 (50.63%), Postives = 53/79 (67.09%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. TrEMBL
Match: A0A0D2T2V4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G187700 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.1e-11 Identity = 40/79 (50.63%), Postives = 55/79 (69.62%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. TrEMBL
Match: F6HF28_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0011g02790 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.0e-11 Identity = 45/96 (46.88%), Postives = 57/96 (59.38%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. TrEMBL
Match: V4TCI5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10033191mg PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.0e-10 Identity = 43/91 (47.25%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. TAIR10
Match: AT1G68765.1 (AT1G68765.1 Putative membrane lipoprotein) HSP 1 Score: 60.8 bits (146), Expect = 4.6e-10 Identity = 34/71 (47.89%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. NCBI nr
Match: gi|659091413|ref|XP_008446537.1| (PREDICTED: protein IDA [Cucumis melo]) HSP 1 Score: 116.7 bits (291), Expect = 2.0e-23 Identity = 66/94 (70.21%), Postives = 73/94 (77.66%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. NCBI nr
Match: gi|700196858|gb|KGN52035.1| (hypothetical protein Csa_5G608230 [Cucumis sativus]) HSP 1 Score: 115.9 bits (289), Expect = 3.4e-23 Identity = 64/88 (72.73%), Postives = 74/88 (84.09%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. NCBI nr
Match: gi|657994058|ref|XP_008389328.1| (PREDICTED: protein IDA [Malus domestica]) HSP 1 Score: 80.1 bits (196), Expect = 2.1e-12 Identity = 49/95 (51.58%), Postives = 58/95 (61.05%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. NCBI nr
Match: gi|694417107|ref|XP_009336645.1| (PREDICTED: protein IDA-like [Pyrus x bretschneideri]) HSP 1 Score: 77.8 bits (190), Expect = 1.0e-11 Identity = 47/93 (50.54%), Postives = 56/93 (60.22%), Query Frame = 1
BLAST of Cp4.1LG01g13370 vs. NCBI nr
Match: gi|596227242|ref|XP_007224213.1| (hypothetical protein PRUPE_ppa017234mg [Prunus persica]) HSP 1 Score: 77.0 bits (188), Expect = 1.8e-11 Identity = 40/79 (50.63%), Postives = 53/79 (67.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|