Lsi08G001810 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTCAAGCTCAACCACGGCGTCTCGGAGCTAACGATTCGGTTTCGAAGCCCTTTCGAGGGGTTCGAAAGAGGAGTTGGGGTCGCTATGTCTCGGAGATACGGCTGCCGGGGAAGAAGACGCGTGTGTGGCTTGGCTCCTTCGCCTCCCCCGAGATGGCAGCGCGTGCCTATGACTCGGCAGCAGCATTTTTGAGAGGCACCTCCGCGGTGCTCAACTTCCCCGACTCTGTGAGCTCGCTCCCACAGCCGGAGTCGTGCTCGAGAGAACACATTCAATCGGCAGCGGCAAAGGCAGCGGCGCAAGTGAGGGAAATGGAGGCAGGAGAGCGAGGAACGAGAAGCGGATGGAGTCCGACGACATTCGAGCAGGTGAAGGAGGCACCATTGTTGAGTCCATTGAGGTTGGGTCTTCTTGGCTTTGGACCAGCCTCAGATGAAGAAGACACTTTGTTGTTACCAGCCTATTTCTAA ATGACTCAAGCTCAACCACGGCGTCTCGGAGCTAACGATTCGGTTTCGAAGCCCTTTCGAGGGGTTCGAAAGAGGAGTTGGGGTCGCTATGTCTCGGAGATACGGCTGCCGGGGAAGAAGACGCGTGTGTGGCTTGGCTCCTTCGCCTCCCCCGAGATGGCAGCGCGTGCCTATGACTCGGCAGCAGCATTTTTGAGAGGCACCTCCGCGGTGCTCAACTTCCCCGACTCTGTGAGCTCGCTCCCACAGCCGGAGTCGTGCTCGAGAGAACACATTCAATCGGCAGCGGCAAAGGCAGCGGCGCAAGTGAGGGAAATGGAGGCAGGAGAGCGAGGAACGAGAAGCGGATGGAGTCCGACGACATTCGAGCAGGTGAAGGAGGCACCATTGTTGAGTCCATTGAGGTTGGGTCTTCTTGGCTTTGGACCAGCCTCAGATGAAGAAGACACTTTGTTGTTACCAGCCTATTTCTAA ATGACTCAAGCTCAACCACGGCGTCTCGGAGCTAACGATTCGGTTTCGAAGCCCTTTCGAGGGGTTCGAAAGAGGAGTTGGGGTCGCTATGTCTCGGAGATACGGCTGCCGGGGAAGAAGACGCGTGTGTGGCTTGGCTCCTTCGCCTCCCCCGAGATGGCAGCGCGTGCCTATGACTCGGCAGCAGCATTTTTGAGAGGCACCTCCGCGGTGCTCAACTTCCCCGACTCTGTGAGCTCGCTCCCACAGCCGGAGTCGTGCTCGAGAGAACACATTCAATCGGCAGCGGCAAAGGCAGCGGCGCAAGTGAGGGAAATGGAGGCAGGAGAGCGAGGAACGAGAAGCGGATGGAGTCCGACGACATTCGAGCAGGTGAAGGAGGCACCATTGTTGAGTCCATTGAGGTTGGGTCTTCTTGGCTTTGGACCAGCCTCAGATGAAGAAGACACTTTGTTGTTACCAGCCTATTTCTAA MTQAQPRRLGANDSVSKPFRGVRKRSWGRYVSEIRLPGKKTRVWLGSFASPEMAARAYDSAAAFLRGTSAVLNFPDSVSSLPQPESCSREHIQSAAAKAAAQVREMEAGERGTRSGWSPTTFEQVKEAPLLSPLRLGLLGFGPASDEEDTLLLPAYF
BLAST of Lsi08G001810 vs. Swiss-Prot
Match: ERF22_ARATH (Ethylene-responsive transcription factor ERF022 OS=Arabidopsis thaliana GN=ERF022 PE=2 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 2.4e-27 Identity = 67/138 (48.55%), Postives = 91/138 (65.94%), Query Frame = 1
BLAST of Lsi08G001810 vs. Swiss-Prot
Match: TINY_ARATH (Ethylene-responsive transcription factor TINY OS=Arabidopsis thaliana GN=TINY PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 4.0e-22 Identity = 63/131 (48.09%), Postives = 82/131 (62.60%), Query Frame = 1
BLAST of Lsi08G001810 vs. Swiss-Prot
Match: ERF23_ARATH (Ethylene-responsive transcription factor ERF023 OS=Arabidopsis thaliana GN=ERF023 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 6.9e-22 Identity = 52/92 (56.52%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of Lsi08G001810 vs. Swiss-Prot
Match: ERF37_ARATH (Ethylene-responsive transcription factor ERF037 OS=Arabidopsis thaliana GN=ERF037 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 6.9e-22 Identity = 51/83 (61.45%), Postives = 69/83 (83.13%), Query Frame = 1
BLAST of Lsi08G001810 vs. Swiss-Prot
Match: ERF36_ARATH (Ethylene-responsive transcription factor ERF036 OS=Arabidopsis thaliana GN=ERF036 PE=2 SV=2) HSP 1 Score: 104.8 bits (260), Expect = 9.0e-22 Identity = 56/102 (54.90%), Postives = 76/102 (74.51%), Query Frame = 1
BLAST of Lsi08G001810 vs. TrEMBL
Match: A0A0A0KSQ8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G647260 PE=4 SV=1) HSP 1 Score: 265.4 bits (677), Expect = 4.4e-68 Identity = 139/163 (85.28%), Postives = 145/163 (88.96%), Query Frame = 1
BLAST of Lsi08G001810 vs. TrEMBL
Match: A0A0L9V8B8_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan08g213800 PE=4 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.9e-34 Identity = 84/130 (64.62%), Postives = 93/130 (71.54%), Query Frame = 1
BLAST of Lsi08G001810 vs. TrEMBL
Match: A0A0S3SEW2_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.06G268700 PE=4 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.9e-34 Identity = 84/130 (64.62%), Postives = 93/130 (71.54%), Query Frame = 1
BLAST of Lsi08G001810 vs. TrEMBL
Match: U5FIC5_POPTR (Uncharacterized protein (Fragment) OS=Populus trichocarpa GN=POPTR_0019s09530g PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 2.7e-33 Identity = 84/135 (62.22%), Postives = 92/135 (68.15%), Query Frame = 1
BLAST of Lsi08G001810 vs. TrEMBL
Match: A9PL84_POPTR (TINY-like protein OS=Populus trichocarpa GN=TINYL15 PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 2.7e-33 Identity = 84/135 (62.22%), Postives = 92/135 (68.15%), Query Frame = 1
BLAST of Lsi08G001810 vs. TAIR10
Match: AT1G33760.1 (AT1G33760.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 123.2 bits (308), Expect = 1.4e-28 Identity = 67/138 (48.55%), Postives = 91/138 (65.94%), Query Frame = 1
BLAST of Lsi08G001810 vs. TAIR10
Match: AT5G25810.1 (AT5G25810.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 105.9 bits (263), Expect = 2.3e-23 Identity = 63/131 (48.09%), Postives = 82/131 (62.60%), Query Frame = 1
BLAST of Lsi08G001810 vs. TAIR10
Match: AT1G01250.1 (AT1G01250.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 105.1 bits (261), Expect = 3.9e-23 Identity = 52/92 (56.52%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of Lsi08G001810 vs. TAIR10
Match: AT1G77200.1 (AT1G77200.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 105.1 bits (261), Expect = 3.9e-23 Identity = 51/83 (61.45%), Postives = 69/83 (83.13%), Query Frame = 1
BLAST of Lsi08G001810 vs. TAIR10
Match: AT3G16280.1 (AT3G16280.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 104.8 bits (260), Expect = 5.1e-23 Identity = 56/102 (54.90%), Postives = 76/102 (74.51%), Query Frame = 1
BLAST of Lsi08G001810 vs. NCBI nr
Match: gi|449447711|ref|XP_004141611.1| (PREDICTED: ethylene-responsive transcription factor ERF022-like [Cucumis sativus]) HSP 1 Score: 265.4 bits (677), Expect = 6.4e-68 Identity = 139/163 (85.28%), Postives = 145/163 (88.96%), Query Frame = 1
BLAST of Lsi08G001810 vs. NCBI nr
Match: gi|659119539|ref|XP_008459710.1| (PREDICTED: ethylene-responsive transcription factor ERF022-like [Cucumis melo]) HSP 1 Score: 253.1 bits (645), Expect = 3.3e-64 Identity = 135/161 (83.85%), Postives = 143/161 (88.82%), Query Frame = 1
BLAST of Lsi08G001810 vs. NCBI nr
Match: gi|950937703|ref|XP_014521333.1| (PREDICTED: dehydration-responsive element-binding protein 3-like [Vigna radiata var. radiata]) HSP 1 Score: 156.8 bits (395), Expect = 3.2e-35 Identity = 87/145 (60.00%), Postives = 98/145 (67.59%), Query Frame = 1
BLAST of Lsi08G001810 vs. NCBI nr
Match: gi|920709314|gb|KOM51311.1| (hypothetical protein LR48_Vigan08g213800 [Vigna angularis]) HSP 1 Score: 153.7 bits (387), Expect = 2.7e-34 Identity = 84/130 (64.62%), Postives = 93/130 (71.54%), Query Frame = 1
BLAST of Lsi08G001810 vs. NCBI nr
Match: gi|1009178830|ref|XP_015870745.1| (PREDICTED: ethylene-responsive transcription factor ERF039-like [Ziziphus jujuba]) HSP 1 Score: 152.5 bits (384), Expect = 6.0e-34 Identity = 86/137 (62.77%), Postives = 94/137 (68.61%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|