Carg27048 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTAAAACTCAACCACAACTTATCGAACGTCGACTCGGATCTAATGTTTCAGTTTCAAGTCCCTTTCGAGGAGTACGGAAGCGGAGTTGGGGTCGCTATGTATCTGAGATACGGTTACCAGGGAAGAAGACACGAGTGTGGCTTGGCTCATTCGCCTCCCCAGAGATGGCCGCACGAGCCTACGACTCGGCAGCTGTATTTTTGAGAGGCACCTCTGCCTTGCTCAACTTTCCTGACTCTGTCGGCTCGCTCCCACAACCAGAGTCATGCTCAAGAGAACATATTCAATTGGCAGCGGCAAAGGCAGCAGCGCAAATGAGAGAGATGGAGGTTGGAGAGCGAAAGGCGAGCAACGGATTGAGTCGGACCATGTTTGAGGAGATGAAGGAAGCACCATTGTTGAGTCCATTGAGGTTGGCTTGGCTTGGGTTTGGACCAGCCTCGGACGAAGAAGACAATTTGTTATTACCAGGCTATTTCTAA ATGACTAAAACTCAACCACAACTTATCGAACGTCGACTCGGATCTAATGTTTCAGTTTCAAGTCCCTTTCGAGGAGTACGGAAGCGGAGTTGGGGTCGCTATGTATCTGAGATACGGTTACCAGGGAAGAAGACACGAGTGTGGCTTGGCTCATTCGCCTCCCCAGAGATGGCCGCACGAGCCTACGACTCGGCAGCTGTATTTTTGAGAGGCACCTCTGCCTTGCTCAACTTTCCTGACTCTGTCGGCTCGCTCCCACAACCAGAGTCATGCTCAAGAGAACATATTCAATTGGCAGCGGCAAAGGCAGCAGCGCAAATGAGAGAGATGGAGGTTGGAGAGCGAAAGGCGAGCAACGGATTGAGTCGGACCATGTTTGAGGAGATGAAGGAAGCACCATTGTTGAGTCCATTGAGGTTGGCTTGGCTTGGGTTTGGACCAGCCTCGGACGAAGAAGACAATTTGTTATTACCAGGCTATTTCTAA ATGACTAAAACTCAACCACAACTTATCGAACGTCGACTCGGATCTAATGTTTCAGTTTCAAGTCCCTTTCGAGGAGTACGGAAGCGGAGTTGGGGTCGCTATGTATCTGAGATACGGTTACCAGGGAAGAAGACACGAGTGTGGCTTGGCTCATTCGCCTCCCCAGAGATGGCCGCACGAGCCTACGACTCGGCAGCTGTATTTTTGAGAGGCACCTCTGCCTTGCTCAACTTTCCTGACTCTGTCGGCTCGCTCCCACAACCAGAGTCATGCTCAAGAGAACATATTCAATTGGCAGCGGCAAAGGCAGCAGCGCAAATGAGAGAGATGGAGGTTGGAGAGCGAAAGGCGAGCAACGGATTGAGTCGGACCATGTTTGAGGAGATGAAGGAAGCACCATTGTTGAGTCCATTGAGGTTGGCTTGGCTTGGGTTTGGACCAGCCTCGGACGAAGAAGACAATTTGTTATTACCAGGCTATTTCTAA MTKTQPQLIERRLGSNVSVSSPFRGVRKRSWGRYVSEIRLPGKKTRVWLGSFASPEMAARAYDSAAVFLRGTSALLNFPDSVGSLPQPESCSREHIQLAAAKAAAQMREMEVGERKASNGLSRTMFEEMKEAPLLSPLRLAWLGFGPASDEEDNLLLPGYF
BLAST of Carg27048 vs. NCBI nr
Match: XP_022930134.1 (ethylene-responsive transcription factor ERF022-like [Cucurbita moschata]) HSP 1 Score: 316.6 bits (810), Expect = 4.8e-83 Identity = 159/161 (98.76%), Postives = 160/161 (99.38%), Query Frame = 0
BLAST of Carg27048 vs. NCBI nr
Match: XP_023536389.1 (ethylene-responsive transcription factor ERF022-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 314.3 bits (804), Expect = 2.4e-82 Identity = 158/161 (98.14%), Postives = 159/161 (98.76%), Query Frame = 0
BLAST of Carg27048 vs. NCBI nr
Match: XP_022974052.1 (ethylene-responsive transcription factor ERF022-like [Cucurbita maxima]) HSP 1 Score: 298.1 bits (762), Expect = 1.8e-77 Identity = 150/161 (93.17%), Postives = 154/161 (95.65%), Query Frame = 0
BLAST of Carg27048 vs. NCBI nr
Match: XP_004141611.1 (PREDICTED: ethylene-responsive transcription factor ERF022-like [Cucumis sativus] >KGN52603.1 hypothetical protein Csa_5G647260 [Cucumis sativus]) HSP 1 Score: 232.3 bits (591), Expect = 1.2e-57 Identity = 125/167 (74.85%), Postives = 137/167 (82.04%), Query Frame = 0
BLAST of Carg27048 vs. NCBI nr
Match: XP_008459710.1 (PREDICTED: ethylene-responsive transcription factor ERF022-like [Cucumis melo]) HSP 1 Score: 225.7 bits (574), Expect = 1.1e-55 Identity = 121/165 (73.33%), Postives = 135/165 (81.82%), Query Frame = 0
BLAST of Carg27048 vs. TAIR10
Match: AT1G33760.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 122.9 bits (307), Expect = 1.8e-28 Identity = 66/138 (47.83%), Postives = 89/138 (64.49%), Query Frame = 0
BLAST of Carg27048 vs. TAIR10
Match: AT5G25810.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 111.7 bits (278), Expect = 4.3e-25 Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Carg27048 vs. TAIR10
Match: AT1G01250.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 107.8 bits (268), Expect = 6.1e-24 Identity = 51/92 (55.43%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of Carg27048 vs. TAIR10
Match: AT5G11590.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 103.2 bits (256), Expect = 1.5e-22 Identity = 49/82 (59.76%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Carg27048 vs. TAIR10
Match: AT1G71450.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 102.8 bits (255), Expect = 2.0e-22 Identity = 64/151 (42.38%), Postives = 83/151 (54.97%), Query Frame = 0
BLAST of Carg27048 vs. Swiss-Prot
Match: sp|Q9LQ28|ERF22_ARATH (Ethylene-responsive transcription factor ERF022 OS=Arabidopsis thaliana OX=3702 GN=ERF022 PE=2 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 3.3e-27 Identity = 66/138 (47.83%), Postives = 89/138 (64.49%), Query Frame = 0
BLAST of Carg27048 vs. Swiss-Prot
Match: sp|Q39127|TINY_ARATH (Ethylene-responsive transcription factor TINY OS=Arabidopsis thaliana OX=3702 GN=TINY PE=2 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 7.7e-24 Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Carg27048 vs. Swiss-Prot
Match: sp|Q1ECI2|ERF23_ARATH (Ethylene-responsive transcription factor ERF023 OS=Arabidopsis thaliana OX=3702 GN=ERF023 PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.1e-22 Identity = 51/92 (55.43%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of Carg27048 vs. Swiss-Prot
Match: sp|Q9LYD3|DREB3_ARATH (Dehydration-responsive element-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=DREB3 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.7e-21 Identity = 49/82 (59.76%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Carg27048 vs. Swiss-Prot
Match: sp|Q9C9I2|ERF21_ARATH (Ethylene-responsive transcription factor ERF021 OS=Arabidopsis thaliana OX=3702 GN=ERF021 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 3.6e-21 Identity = 64/151 (42.38%), Postives = 83/151 (54.97%), Query Frame = 0
BLAST of Carg27048 vs. TrEMBL
Match: tr|A0A0A0KSQ8|A0A0A0KSQ8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G647260 PE=4 SV=1) HSP 1 Score: 232.3 bits (591), Expect = 7.9e-58 Identity = 125/167 (74.85%), Postives = 137/167 (82.04%), Query Frame = 0
BLAST of Carg27048 vs. TrEMBL
Match: tr|A0A1S3CAB8|A0A1S3CAB8_CUCME (ethylene-responsive transcription factor ERF022-like OS=Cucumis melo OX=3656 GN=LOC103498753 PE=4 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 7.4e-56 Identity = 121/165 (73.33%), Postives = 135/165 (81.82%), Query Frame = 0
BLAST of Carg27048 vs. TrEMBL
Match: tr|A9PL84|A9PL84_POPTR (TINY-like protein OS=Populus trichocarpa OX=3694 GN=TINYL15 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 4.2e-35 Identity = 87/136 (63.97%), Postives = 96/136 (70.59%), Query Frame = 0
BLAST of Carg27048 vs. TrEMBL
Match: tr|A0A2K1WQR6|A0A2K1WQR6_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_019G067400v3 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 4.2e-35 Identity = 87/136 (63.97%), Postives = 96/136 (70.59%), Query Frame = 0
BLAST of Carg27048 vs. TrEMBL
Match: tr|A9PL85|A9PL85_POPTR (TINY-like protein OS=Populus trichocarpa OX=3694 GN=TINYL16 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 4.2e-35 Identity = 87/136 (63.97%), Postives = 96/136 (70.59%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |