MELO3C033736.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTCAATCTCCTTCACGACAGCCTTAACAACATTCGCACAGCCACTTCTCGCCTCGACATTGCCTCCGCTGCACTCCACGATCTCTCGCTCCGTCCTCAAGGTTGGTTCCTTTCTCTTTTTTTCATTTCTTCTTCATAATTTAATCTTTTTTTTTTTTATGTGGCTATTTGGTGATTTTTTTTTTTCTGTTTTCTTAGGCAAGAGGATGTTGGTGCCTCTTACTGCGTCGCTTTATGTTCCTGGGACGCTTGATGAGGCCGATAAGGTCTTGGTGGATGTAGGCA ATGGAAGTCAATCTCCTTCACGACAGCCTTAACAACATTCGCACAGCCACTTCTCGCCTCGACATTGCCTCCGCTGCACTCCACGATCTCTCGCTCCGTCCTCAAGGCAAGAGGATGTTGGTGCCTCTTACTGCGTCGCTTTATGTTCCTGGGACGCTTGATGAGGCCGATAAGGTCTTGGTGGATGTAGGCA ATGGAAGTCAATCTCCTTCACGACAGCCTTAACAACATTCGCACAGCCACTTCTCGCCTCGACATTGCCTCCGCTGCACTCCACGATCTCTCGCTCCGTCCTCAAGGCAAGAGGATGTTGGTGCCTCTTACTGCGTCGCTTTATGTTCCTGGGACGCTTGATGAGGCCGATAAGGTCTTGGTGGATGTAGGC MEVNLLHDSLNNIRTATSRLDIASAALHDLSLRPQGKRMLVPLTASLYVPGTLDEADKVLVDVG
BLAST of MELO3C033736.2 vs. NCBI nr
Match: XP_004149870.1 (PREDICTED: probable prefoldin subunit 5 [Cucumis sativus] >KGN50940.1 hypothetical protein Csa_5G352600 [Cucumis sativus]) HSP 1 Score: 125.2 bits (313), Expect = 8.2e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C033736.2 vs. NCBI nr
Match: XP_008467005.1 (PREDICTED: probable prefoldin subunit 5 [Cucumis melo]) HSP 1 Score: 123.6 bits (309), Expect = 2.4e-25 Identity = 63/64 (98.44%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C033736.2 vs. NCBI nr
Match: XP_008437670.1 (PREDICTED: uncharacterized protein LOC103483010 [Cucumis melo]) HSP 1 Score: 122.9 bits (307), Expect = 4.0e-25 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C033736.2 vs. NCBI nr
Match: XP_022938455.1 (probable prefoldin subunit 5 [Cucurbita moschata] >XP_022938456.1 probable prefoldin subunit 5 [Cucurbita moschata]) HSP 1 Score: 121.7 bits (304), Expect = 9.0e-25 Identity = 61/64 (95.31%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C033736.2 vs. NCBI nr
Match: XP_023549859.1 (probable prefoldin subunit 5 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 121.7 bits (304), Expect = 9.0e-25 Identity = 61/64 (95.31%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C033736.2 vs. TAIR10
Match: AT5G23290.1 (prefoldin 5) HSP 1 Score: 111.3 bits (277), Expect = 2.2e-25 Identity = 56/64 (87.50%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of MELO3C033736.2 vs. Swiss-Prot
Match: sp|P57742|PFD5_ARATH (Probable prefoldin subunit 5 OS=Arabidopsis thaliana OX=3702 GN=At5g23290 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.0e-24 Identity = 56/64 (87.50%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of MELO3C033736.2 vs. Swiss-Prot
Match: sp|Q8HYI9|PFD5_BOVIN (Prefoldin subunit 5 OS=Bos taurus OX=9913 GN=PFDN5 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.1e-05 Identity = 25/63 (39.68%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of MELO3C033736.2 vs. Swiss-Prot
Match: sp|Q99471|PFD5_HUMAN (Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2) HSP 1 Score: 50.1 bits (118), Expect = 1.1e-05 Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 0
BLAST of MELO3C033736.2 vs. Swiss-Prot
Match: sp|Q9WU28|PFD5_MOUSE (Prefoldin subunit 5 OS=Mus musculus OX=10090 GN=Pfdn5 PE=1 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.1e-05 Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 0
BLAST of MELO3C033736.2 vs. Swiss-Prot
Match: sp|Q5RAY0|PFD5_PONAB (Prefoldin subunit 5 OS=Pongo abelii OX=9601 GN=PFDN5 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.1e-05 Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 0
BLAST of MELO3C033736.2 vs. TrEMBL
Match: tr|A0A0A0KMS5|A0A0A0KMS5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G352600 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 5.4e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C033736.2 vs. TrEMBL
Match: tr|A0A1S3CSP1|A0A1S3CSP1_CUCME (probable prefoldin subunit 5 OS=Cucumis melo OX=3656 GN=LOC103504416 PE=4 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.6e-25 Identity = 63/64 (98.44%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C033736.2 vs. TrEMBL
Match: tr|A0A1S3AV61|A0A1S3AV61_CUCME (uncharacterized protein LOC103483010 OS=Cucumis melo OX=3656 GN=LOC103483010 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.7e-25 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C033736.2 vs. TrEMBL
Match: tr|B9S4J8|B9S4J8_RICCO (Prefoldin subunit, putative OS=Ricinus communis OX=3988 GN=RCOM_0809120 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 5.6e-23 Identity = 57/64 (89.06%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of MELO3C033736.2 vs. TrEMBL
Match: tr|A0A218VSX5|A0A218VSX5_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr008037 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 2.1e-22 Identity = 56/64 (87.50%), Postives = 63/64 (98.44%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|