MELO3C008511 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACGGGTCCATCGTCGTCCAAACAAGGGTGATCGGAACCTCAAAATCATAGATGTAAGAAAACTAAGCGAAAACAAGATGCACCTAAATCAATCACGTCGTCATTCTACCATTGATCCATCGTCAATGAAACCACGTGCGATCAAGACAACTTCAGAATCCTCGAAAGCATCAACTGTGAAGTTATGGTGGAAGAACTCAGAAATGAAGAGGCGACGACGCGTTGCAAAGTACAAGTTGTATACAGTGGAAGGGAGGGTCAAAGAGTCCATAAGAAAAGGGATAAATTGGTTCAAATGCAGATGTACCAGAATTATTTCTGGATTTTGA ATGGAACGGGTCCATCGTCGTCCAAACAAGGGTGATCGGAACCTCAAAATCATAGATGTAAGAAAACTAAGCGAAAACAAGATGCACCTAAATCAATCACGTCGTCATTCTACCATTGATCCATCGTCAATGAAACCACGTGCGATCAAGACAACTTCAGAATCCTCGAAAGCATCAACTGTGAAGTTATGGTGGAAGAACTCAGAAATGAAGAGGCGACGACGCGTTGCAAAGTACAAGTTGTATACAGTGGAAGGGAGGGTCAAAGAGTCCATAAGAAAAGGGATAAATTGGTTCAAATGCAGATGTACCAGAATTATTTCTGGATTTTGA ATGGAACGGGTCCATCGTCGTCCAAACAAGGGTGATCGGAACCTCAAAATCATAGATGTAAGAAAACTAAGCGAAAACAAGATGCACCTAAATCAATCACGTCGTCATTCTACCATTGATCCATCGTCAATGAAACCACGTGCGATCAAGACAACTTCAGAATCCTCGAAAGCATCAACTGTGAAGTTATGGTGGAAGAACTCAGAAATGAAGAGGCGACGACGCGTTGCAAAGTACAAGTTGTATACAGTGGAAGGGAGGGTCAAAGAGTCCATAAGAAAAGGGATAAATTGGTTCAAATGCAGATGTACCAGAATTATTTCTGGATTTTGA MERVHRRPNKGDRNLKIIDVRKLSENKMHLNQSRRHSTIDPSSMKPRAIKTTSESSKASTVKLWWKNSEMKRRRRVAKYKLYTVEGRVKESIRKGINWFKCRCTRIISGF*
BLAST of MELO3C008511 vs. TrEMBL
Match: A0A0A0LL30_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G123580 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.5e-41 Identity = 86/110 (78.18%), Postives = 97/110 (88.18%), Query Frame = 1
BLAST of MELO3C008511 vs. TrEMBL
Match: A0A0A0L7N5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G077700 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.2e-30 Identity = 68/110 (61.82%), Postives = 85/110 (77.27%), Query Frame = 1
BLAST of MELO3C008511 vs. TrEMBL
Match: M5W2H8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024789mg PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.5e-14 Identity = 48/107 (44.86%), Postives = 64/107 (59.81%), Query Frame = 1
BLAST of MELO3C008511 vs. TrEMBL
Match: A0A067H7X9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g045042mg PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 8.4e-13 Identity = 42/105 (40.00%), Postives = 68/105 (64.76%), Query Frame = 1
BLAST of MELO3C008511 vs. TrEMBL
Match: M4FHE8_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 42/108 (38.89%), Postives = 63/108 (58.33%), Query Frame = 1
BLAST of MELO3C008511 vs. TAIR10
Match: AT3G05725.1 (AT3G05725.1 Protein of unknown function (DUF3511)) HSP 1 Score: 75.9 bits (185), Expect = 1.8e-14 Identity = 40/108 (37.04%), Postives = 63/108 (58.33%), Query Frame = 1
BLAST of MELO3C008511 vs. TAIR10
Match: AT2G47480.1 (AT2G47480.1 Protein of unknown function (DUF3511)) HSP 1 Score: 58.2 bits (139), Expect = 3.9e-09 Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
BLAST of MELO3C008511 vs. TAIR10
Match: AT3G62640.1 (AT3G62640.1 Protein of unknown function (DUF3511)) HSP 1 Score: 55.5 bits (132), Expect = 2.5e-08 Identity = 26/72 (36.11%), Postives = 39/72 (54.17%), Query Frame = 1
BLAST of MELO3C008511 vs. TAIR10
Match: AT2G19460.1 (AT2G19460.1 Protein of unknown function (DUF3511)) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-06 Identity = 22/69 (31.88%), Postives = 39/69 (56.52%), Query Frame = 1
BLAST of MELO3C008511 vs. TAIR10
Match: AT1G72720.1 (AT1G72720.1 Protein of unknown function (DUF3511)) HSP 1 Score: 48.9 bits (115), Expect = 2.3e-06 Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 1
BLAST of MELO3C008511 vs. NCBI nr
Match: gi|659082109|ref|XP_008441676.1| (PREDICTED: uncharacterized protein LOC103485754 [Cucumis melo]) HSP 1 Score: 226.5 bits (576), Expect = 2.3e-56 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of MELO3C008511 vs. NCBI nr
Match: gi|700206328|gb|KGN61447.1| (hypothetical protein Csa_2G123580 [Cucumis sativus]) HSP 1 Score: 176.8 bits (447), Expect = 2.1e-41 Identity = 86/110 (78.18%), Postives = 97/110 (88.18%), Query Frame = 1
BLAST of MELO3C008511 vs. NCBI nr
Match: gi|700201003|gb|KGN56136.1| (hypothetical protein Csa_3G077700 [Cucumis sativus]) HSP 1 Score: 140.6 bits (353), Expect = 1.7e-30 Identity = 68/110 (61.82%), Postives = 85/110 (77.27%), Query Frame = 1
BLAST of MELO3C008511 vs. NCBI nr
Match: gi|659126920|ref|XP_008463430.1| (PREDICTED: uncharacterized protein LOC103501594 [Cucumis melo]) HSP 1 Score: 135.6 bits (340), Expect = 5.4e-29 Identity = 67/110 (60.91%), Postives = 83/110 (75.45%), Query Frame = 1
BLAST of MELO3C008511 vs. NCBI nr
Match: gi|595833761|ref|XP_007206730.1| (hypothetical protein PRUPE_ppa024789mg [Prunus persica]) HSP 1 Score: 85.5 bits (210), Expect = 6.4e-14 Identity = 48/107 (44.86%), Postives = 64/107 (59.81%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|