MELO3C005991.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCGGCGGAGAGAGACGACGGCAGTCCGGCGCCGCCGTACCGAAGGGGTGTTTGGCGGTGAAAGTGGGGCAGAAAGGGGAAGAGCAGCAGAGATTTGTGGTGCCGGTGATGTACTTCAATCACCCGCGGTTCATGCAATTACTGAAAGAGGCAGAGGAAGAGTACGGATTCGATCAGAAGGGGACCATCGCTATTCCTTGCCACGTGGAAGAGTTTCGGCACGTGCAAGGAATGATCGACCGTGAAAATTCATTCCACCGCCGTCACAACCACCACCACCACCACCACAGCCACCACCTCGGTTGCTTTCGGGTTTCCTTCTGA ATGGGCGGCGGAGAGAGACGACGGCAGTCCGGCGCCGCCGTACCGAAGGGGTGTTTGGCGGTGAAAGTGGGGCAGAAAGGGGAAGAGCAGCAGAGATTTGTGGTGCCGGTGATGTACTTCAATCACCCGCGGTTCATGCAATTACTGAAAGAGGCAGAGGAAGAGTACGGATTCGATCAGAAGGGGACCATCGCTATTCCTTGCCACGTGGAAGAGTTTCGGCACGTGCAAGGAATGATCGACCGTGAAAATTCATTCCACCGCCGTCACAACCACCACCACCACCACCACAGCCACCACCTCGGTTGCTTTCGGGTTTCCTTCTGA ATGGGCGGCGGAGAGAGACGACGGCAGTCCGGCGCCGCCGTACCGAAGGGGTGTTTGGCGGTGAAAGTGGGGCAGAAAGGGGAAGAGCAGCAGAGATTTGTGGTGCCGGTGATGTACTTCAATCACCCGCGGTTCATGCAATTACTGAAAGAGGCAGAGGAAGAGTACGGATTCGATCAGAAGGGGACCATCGCTATTCCTTGCCACGTGGAAGAGTTTCGGCACGTGCAAGGAATGATCGACCGTGAAAATTCATTCCACCGCCGTCACAACCACCACCACCACCACCACAGCCACCACCTCGGTTGCTTTCGGGTTTCCTTCTGA MGGGERRRQSGAAVPKGCLAVKVGQKGEEQQRFVVPVMYFNHPRFMQLLKEAEEEYGFDQKGTIAIPCHVEEFRHVQGMIDRENSFHRRHNHHHHHHSHHLGCFRVSF
BLAST of MELO3C005991.2 vs. NCBI nr
Match: XP_004133791.1 (PREDICTED: auxin-induced protein X15-like [Cucumis sativus] >KGN56389.1 hypothetical protein Csa_3G118740 [Cucumis sativus]) HSP 1 Score: 183.3 bits (464), Expect = 4.3e-43 Identity = 105/111 (94.59%), Postives = 105/111 (94.59%), Query Frame = 0
BLAST of MELO3C005991.2 vs. NCBI nr
Match: XP_022924405.1 (auxin-responsive protein SAUR32-like [Cucurbita moschata]) HSP 1 Score: 180.3 bits (456), Expect = 3.6e-42 Identity = 98/109 (89.91%), Postives = 100/109 (91.74%), Query Frame = 0
BLAST of MELO3C005991.2 vs. NCBI nr
Match: XP_022979593.1 (auxin-responsive protein SAUR32-like [Cucurbita maxima]) HSP 1 Score: 172.2 bits (435), Expect = 9.8e-40 Identity = 97/109 (88.99%), Postives = 100/109 (91.74%), Query Frame = 0
BLAST of MELO3C005991.2 vs. NCBI nr
Match: XP_023526937.1 (auxin-responsive protein SAUR32-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 171.4 bits (433), Expect = 1.7e-39 Identity = 100/110 (90.91%), Postives = 103/110 (93.64%), Query Frame = 0
BLAST of MELO3C005991.2 vs. NCBI nr
Match: XP_023540249.1 (auxin-responsive protein SAUR32-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 170.6 bits (431), Expect = 2.9e-39 Identity = 98/109 (89.91%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TAIR10
Match: AT2G46690.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 132.9 bits (333), Expect = 1.2e-31 Identity = 66/97 (68.04%), Postives = 76/97 (78.35%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TAIR10
Match: AT4G00880.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 130.6 bits (327), Expect = 5.9e-31 Identity = 61/72 (84.72%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TAIR10
Match: AT3G61900.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 127.5 bits (319), Expect = 5.0e-30 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TAIR10
Match: AT5G53590.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 92.4 bits (228), Expect = 1.8e-19 Identity = 41/72 (56.94%), Postives = 55/72 (76.39%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TAIR10
Match: AT3G60690.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 84.7 bits (208), Expect = 3.7e-17 Identity = 41/84 (48.81%), Postives = 56/84 (66.67%), Query Frame = 0
BLAST of MELO3C005991.2 vs. Swiss-Prot
Match: sp|Q9ZUZ3|SAU32_ARATH (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana OX=3702 GN=SAUR32 PE=2 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.2e-30 Identity = 66/97 (68.04%), Postives = 76/97 (78.35%), Query Frame = 0
BLAST of MELO3C005991.2 vs. Swiss-Prot
Match: sp|O22150|SAU36_ARATH (Auxin-responsive protein SAUR36 OS=Arabidopsis thaliana OX=3702 GN=SAUR36 PE=2 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.4e-13 Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 0
BLAST of MELO3C005991.2 vs. Swiss-Prot
Match: sp|Q41220|SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana OX=3702 GN=SAUR15 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.9e-11 Identity = 33/81 (40.74%), Postives = 51/81 (62.96%), Query Frame = 0
BLAST of MELO3C005991.2 vs. Swiss-Prot
Match: sp|P33082|AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.5e-10 Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 0
BLAST of MELO3C005991.2 vs. Swiss-Prot
Match: sp|P33081|AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.5e-10 Identity = 34/79 (43.04%), Postives = 47/79 (59.49%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TrEMBL
Match: tr|A0A0A0L5S7|A0A0A0L5S7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G118740 PE=4 SV=1) HSP 1 Score: 183.3 bits (464), Expect = 2.8e-43 Identity = 105/111 (94.59%), Postives = 105/111 (94.59%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TrEMBL
Match: tr|A0A2P4J2R6|A0A2P4J2R6_QUESU (Auxin-responsive protein saur32 OS=Quercus suber OX=58331 GN=CFP56_15842 PE=4 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.9e-31 Identity = 71/93 (76.34%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TrEMBL
Match: tr|A0A0A0KFM7|A0A0A0KFM7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G106780 PE=4 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.9e-31 Identity = 65/87 (74.71%), Postives = 76/87 (87.36%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TrEMBL
Match: tr|V4VXA0|V4VXA0_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10022948mg PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 3.2e-31 Identity = 71/93 (76.34%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of MELO3C005991.2 vs. TrEMBL
Match: tr|A0A067H3X5|A0A067H3X5_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g033760mg PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 3.2e-31 Identity = 71/93 (76.34%), Postives = 75/93 (80.65%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|